PDB entry 3kto

View 3kto on RCSB PDB site
Description: Crystal structure of response regulator receiver protein from Pseudoalteromonas atlantica
Class: transcription regulator
Keywords: Response regulator receiver protein, PSI-II,Structural Genomics, Protein Structure Initiative, New York SGX Research Center for Structural Genomics, NYSGXRC , New York SGX Research Center for Structural Genomics
Deposited on 2009-11-25, released 2009-12-15
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-12-15, with a file datestamp of 2009-12-11.
Experiment type: XRAY
Resolution: 1.98 Å
R-factor: 0.218
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Response regulator receiver protein
    Species: Pseudoalteromonas atlantica T6c [TaxId:342610]
    Gene: Patl_2095
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3ktoa_
  • Chain 'B':
    Compound: Response regulator receiver protein
    Species: Pseudoalteromonas atlantica T6c [TaxId:342610]
    Gene: Patl_2095
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3ktob_
  • Chain 'C':
    Compound: Response regulator receiver protein
    Species: Pseudoalteromonas atlantica T6c [TaxId:342610]
    Gene: Patl_2095
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3ktoc_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3ktoA (A:)
    mslnhhpiiylvdhqkdaraalskllspldvtiqcfasaesfmrqqisddaigmiieahl
    edkkdsgielletlvkrgfhlptivmasssdiptavramrasaadfiekpfiehvlvhdv
    qqiingakeghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ktoA (A:)
    piiylvdhqkdaraalskllspldvtiqcfasaesfmrqqisddaigmiieahledkkds
    gielletlvkrgfhlptivmasssdiptavramrasaadfiekpfiehvlvhdvqqiing
    ak
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3ktoB (B:)
    mslnhhpiiylvdhqkdaraalskllspldvtiqcfasaesfmrqqisddaigmiieahl
    edkkdsgielletlvkrgfhlptivmasssdiptavramrasaadfiekpfiehvlvhdv
    qqiingakeghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ktoB (B:)
    piiylvdhqkdaraalskllspldvtiqcfasaesfmrqqisddaigmiieahledkkds
    gielletlvkrgfhlptivmasssdiptavramrasaadfiekpfiehvlvhdvqqiing
    ak
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3ktoC (C:)
    mslnhhpiiylvdhqkdaraalskllspldvtiqcfasaesfmrqqisddaigmiieahl
    edkkdsgielletlvkrgfhlptivmasssdiptavramrasaadfiekpfiehvlvhdv
    qqiingakeghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ktoC (C:)
    piiylvdhqkdaraalskllspldvtiqcfasaesfmrqqisddaigmiieahledkkds
    gielletlvkrgfhlptivmasssdiptavramrasaadfiekpfiehvlvhdvqqiing