SCOPe 2.08: Structural Classification of Proteins

PDB entry 3ktg

View 3ktg on RCSB PDB site
Description: Structure of ClpP from Bacillus subtilis in monoclinic crystal form
Class: hydrolase
Keywords: hydrolase, ATP-binding, Nucleotide-binding, Protease, Serine protease, Stress response
Deposited on 2009-11-25, released 2010-03-23
The last revision prior to the SCOPe 2.08 freeze date was dated 2010-11-03, with a file datestamp of 2010-10-29.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.212
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

Chain 'A':
Compound: ATP-dependent Clp protease proteolytic subunit
Species: Bacillus subtilis [TaxId:1423]
Gene: clpP, yvdN, BSU34540
Database cross-references and differences (RAF-indexed):
- Uniprot P80244 (Start-195)
  - engineered (191)
  - engineered (193-195)
  - expression tag (196-197)
Domains in SCOPe 2.08: d3ktga1, d3ktga2
Chain 'B':
Compound: ATP-dependent Clp protease proteolytic subunit
Species: Bacillus subtilis [TaxId:1423]
Gene: clpP, yvdN, BSU34540
Database cross-references and differences (RAF-indexed):
- Uniprot P80244 (Start-195)
  - engineered (191)
  - engineered (193-195)
  - expression tag (196-197)
Domains in SCOPe 2.08: d3ktgb1, d3ktgb2
Chain 'C':
Compound: ATP-dependent Clp protease proteolytic subunit
Species: Bacillus subtilis [TaxId:1423]
Gene: clpP, yvdN, BSU34540
Database cross-references and differences (RAF-indexed):
- Uniprot P80244 (Start-195)
  - engineered (191)
  - engineered (193-195)
  - expression tag (196-197)
Domains in SCOPe 2.08: d3ktgc1, d3ktgc2
Chain 'D':
Compound: ATP-dependent Clp protease proteolytic subunit
Species: Bacillus subtilis [TaxId:1423]
Gene: clpP, yvdN, BSU34540
Database cross-references and differences (RAF-indexed):
- Uniprot P80244 (Start-195)
  - engineered (191)
  - engineered (193-195)
  - expression tag (196-197)
Domains in SCOPe 2.08: d3ktgd1, d3ktgd2
Chain 'E':
Compound: ATP-dependent Clp protease proteolytic subunit
Species: Bacillus subtilis [TaxId:1423]
Gene: clpP, yvdN, BSU34540
Database cross-references and differences (RAF-indexed):
- Uniprot P80244 (Start-195)
  - engineered (191)
  - engineered (193-195)
  - expression tag (196-197)
Domains in SCOPe 2.08: d3ktge1, d3ktge2
Chain 'F':
Compound: ATP-dependent Clp protease proteolytic subunit
Species: Bacillus subtilis [TaxId:1423]
Gene: clpP, yvdN, BSU34540
Database cross-references and differences (RAF-indexed):
- Uniprot P80244 (Start-195)
  - engineered (191)
  - engineered (193-195)
  - expression tag (196-197)
Domains in SCOPe 2.08: d3ktgf1, d3ktgf2
Chain 'G':
Compound: ATP-dependent Clp protease proteolytic subunit
Species: Bacillus subtilis [TaxId:1423]
Gene: clpP, yvdN, BSU34540
Database cross-references and differences (RAF-indexed):
- Uniprot P80244 (Start-195)
  - engineered (191)
  - engineered (193-195)
  - expression tag (196-197)
Domains in SCOPe 2.08: d3ktgg1, d3ktgg2
Heterogens: HOH

PDB Chain Sequences:

Chain 'A':
Sequence, based on SEQRES records: (download)

>3ktgA (A:)
nliptvieqtnrgeraydiysrllkdriimlgsaiddnvansivsqllflaaedpekeis
lyinspggsitagmaiydtmqfikpkvsticigmaasmgafllaagekgkryalpnsevm
ihqplggaqgqateieiaakrilllrdklnkvlaertgqplevierdtdrdnfksaeeal
eyglidkilthlehhhhhh