PDB entry 3kt5

View 3kt5 on RCSB PDB site
Description: Crystal Structure of N88S mutant HIV-1 Protease
Class: hydrolase
Keywords: Drug Resistant, Mutation, HIV-1 protease, N88S, Nelfinavir, Hydrolase, Protease
Deposited on 2009-11-24, released 2010-02-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-08-23, with a file datestamp of 2017-08-18.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protease
    Species: Human immunodeficiency virus type 1 [TaxId:11706]
    Gene: gag-pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04585 (104-202)
      • engineered (87)
      • engineered (94)
      • engineered (191)
      • engineered (198)
    Domains in SCOPe 2.07: d3kt5a1, d3kt5a2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3kt5A (A:)
    pqvtlwqrplvtikiggqlkealldtgaddtvleemslpgrwkpkmiggiggfikvrqyd
    qilieicghkaigtvlvgptpvniigrslltqigatlnfggssgpqvtlwqrplvtikig
    gqlkealldtgaddtvleemslpgrwkpkmiggiggfikvrqydqilieicghkaigtvl
    vgptpvniigrslltqigatlnf
    

    Sequence, based on observed residues (ATOM records): (download)
    >3kt5A (A:)
    pqvtlwqrplvtikiggqlkealldtgaddtvleemslpgrwkpkmiggiggfikvrqyd
    qilieicghkaigtvlvgptpvniigrslltqigatlnfpqvtlwqrplvtikiggqlke
    alldtgaddtvleemslpgrwkpkmiggiggfikvrqydqilieicghkaigtvlvgptp
    vniigrslltqigatlnf