PDB entry 3ks0

View 3ks0 on RCSB PDB site
Description: Crystal structure of the heme domain of flavocytochrome b2 in complex with Fab B2B4
Class: oxidoreductase
Keywords: electron transfer, epitope, domain mobility, flavocytochrome b2, antibody, Fab, heme domain, Electron transport, Flavoprotein, FMN, Heme, Metal-binding, Mitochondrion, Oxidoreductase, Respiratory chain, Transit peptide, Transport
Deposited on 2009-11-20, released 2010-05-26
The last revision prior to the SCOPe 2.06 freeze date was dated 2010-08-18, with a file datestamp of 2010-08-13.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.218
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cytochrome b2, mitochondrial
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: CYB2, YML054C, YM9958.08C
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3ks0a_
  • Chain 'B':
    Compound: Cytochrome b2, mitochondrial
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: CYB2, YML054C, YM9958.08C
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3ks0b_
  • Chain 'H':
    Compound: Fragment Antigen Binding B2B4
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3KS0 (0-End)
  • Chain 'J':
    Compound: heme domain of flavocytochrome b2
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3KS0 (0-End)
    Domains in SCOPe 2.06: d3ks0j1, d3ks0j2
  • Chain 'K':
    Compound: Fragment Antigen Binding B2B4
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3KS0 (0-End)
  • Chain 'L':
    Compound: heme domain of flavocytochrome b2
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3KS0 (0-End)
    Domains in SCOPe 2.06: d3ks0l1, d3ks0l2
  • Heterogens: HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3ks0A (A:)
    mnkqkispaevakhnkpddcwvvingyvydltrflpnhpggqdvikfnagkdvtaifepl
    hapnvidkyiapekklgplqgsmppelvcppyapg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ks0A (A:)
    mnkqkispaevakhnkpddcwvvingyvydltrflpnhpggqdvikfnagkdvtaifepl
    hapnvidkyiapekklgplqgsmppelvcppy
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3ks0B (B:)
    mnkqkispaevakhnkpddcwvvingyvydltrflpnhpggqdvikfnagkdvtaifepl
    hapnvidkyiapekklgplqgsmppelvcppyapg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ks0B (B:)
    mnkqkispaevakhnkpddcwvvingyvydltrflpnhpggqdvikfnagkdvtaifepl
    hapnvidkyiapekklgplqgsmppelvcppy
    

  • Chain 'H':
    No sequence available.

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >3ks0J (J:)
    qavvtqesalttspgetvtltcrsstgavttsnyanwvqekpdhlftgliggtnkrapgv
    parfsgsligdkaaltitgaqtedeaiyfcalwdsnhlvfgggtkltvlgqpksspsvtl
    fppsseeletnkatlvctitdfypgvvtvdwkvdgtpvtqgmettqpskqsnnkymassy
    ltltarawerhssyscqvtheghtvekslspadc
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ks0J (J:)
    qavvtqesalttspgetvtltcrsstgavttsnyanwvqekpdhlftgliggtnkrapgv
    parfsgsligdkaaltitgaqtedeaiyfcalwdsnhlvfgggtkltvlgqpksspsvtl
    fppsseeletnkatlvctitdfypgvvtvdwkvdgtpvtqgmettqpskqsnnkymassy
    ltltarawerhssyscqvtheghtvekslspa
    

  • Chain 'K':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >3ks0L (L:)
    qavvtqesalttspgetvtltcrsstgavttsnyanwvqekpdhlftgliggtnkrapgv
    parfsgsligdkaaltitgaqtedeaiyfcalwdsnhlvfgggtkltvlgqpksspsvtl
    fppsseeletnkatlvctitdfypgvvtvdwkvdgtpvtqgmettqpskqsnnkymassy
    ltltarawerhssyscqvtheghtvekslspadc
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ks0L (L:)
    qavvtqesalttspgetvtltcrsstgavttsnyanwvqekpdhlftgliggtnkrapgv
    parfsgsligdkaaltitgaqtedeaiyfcalwdsnhlvfgggtkltvlgqpksspsvtl
    fppsseeletnkatlvctitdfypgvvtvdwkvdgtpvtqgmettqpskqsnnkymassy
    ltltarawerhssyscqvtheghtvekslspa