PDB entry 3kro

View 3kro on RCSB PDB site
Description: Mint heterotetrameric geranyl pyrophosphate synthase in complex with magnesium, IPP, and DMASPP (II)
Class: transferase
Keywords: prenyltransferase, Isoprene biosynthesis, isoprenyl pyrophosphate synthase, TRANSFERASE
Deposited on 2009-11-19, released 2010-02-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Geranyl diphosphate synthase large subunit
    Species: Mentha x piperita [TaxId:34256]
    Gene: GPPS Large Subunit
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9SBR3 (1-294)
      • expression tag (0)
    Domains in SCOPe 2.07: d3kroa1, d3kroa2
  • Chain 'B':
    Compound: Geranyl diphosphate synthase small subunit
    Species: Mentha x piperita [TaxId:34256]
    Gene: GPPS Small subunit
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9SBR4 (1-End)
      • expression tag (0)
  • Chain 'C':
    Compound: Geranyl diphosphate synthase small subunit
    Species: Mentha x piperita [TaxId:34256]
    Gene: GPPS Small subunit
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9SBR4 (1-End)
      • expression tag (0)
  • Chain 'D':
    Compound: Geranyl diphosphate synthase large subunit
    Species: Mentha x piperita [TaxId:34256]
    Gene: GPPS Large Subunit
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9SBR3 (1-294)
      • expression tag (0)
    Domains in SCOPe 2.07: d3krod1, d3krod2
  • Heterogens: IPE, PPV, MG, EDO, DST, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3kroA (A:)
    mfdfdgymlrkaksvnkaleaavqmkeplkihesmrysllaggkrvrpmlciaacelvgg
    destampaacavemihtmslmhddlpcmdnddlrrgkptnhmafgesvavlagdallsfa
    fehvaaatkgapperivrvlgelavsigseglvagqvvdvcsegmaevgldhlefihhhk
    taallqgsvvlgailgggkeeevaklrkfancigllfqvvddildvtksskelgktagkd
    lvadkttypkligvekskefadrlnreaqeqllhfhphraaplialanyiayrdn
    

    Sequence, based on observed residues (ATOM records): (download)
    >3kroA (A:)
    mfdfdgymlrkaksvnkaleaavqmkeplkihesmrysllaggkrvrpmlciaacelvgg
    destampaacavemihtmslmhddlpcmdnddlrrgkptnhmafgesvavlagdallsfa
    fehvaaatkgapperivrvlgelavsigseglvagqvvdvcsegmaevgldhlefihhhk
    taallqgsvvlgailgggkeeevaklrkfancigllfqvvddildvtkkttypkligvek
    skefadrlnreaqeqllhfhphraaplialanyiayrdn
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3kroD (D:)
    mfdfdgymlrkaksvnkaleaavqmkeplkihesmrysllaggkrvrpmlciaacelvgg
    destampaacavemihtmslmhddlpcmdnddlrrgkptnhmafgesvavlagdallsfa
    fehvaaatkgapperivrvlgelavsigseglvagqvvdvcsegmaevgldhlefihhhk
    taallqgsvvlgailgggkeeevaklrkfancigllfqvvddildvtksskelgktagkd
    lvadkttypkligvekskefadrlnreaqeqllhfhphraaplialanyiayrdn