PDB entry 3krf

View 3krf on RCSB PDB site
Description: Mint heterotetrameric geranyl pyrophosphate synthase in complex with magnesium, IPP, and DMASPP (I)
Class: transferase
Keywords: prenyltransferase, Isoprene biosynthesis, isoprenyl pyrophosphate synthase, TRANSFERASE
Deposited on 2009-11-18, released 2010-02-23
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-02-12, with a file datestamp of 2014-02-07.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.192
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Geranyl diphosphate synthase large subunit
    Species: Mentha x piperita [TaxId:34256]
    Gene: GPPS Large Subunit
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9SBR3 (1-294)
      • expression tag (0)
    Domains in SCOPe 2.06: d3krfa1, d3krfa2
  • Chain 'B':
    Compound: Geranyl diphosphate synthase small subunit
    Species: Mentha x piperita [TaxId:34256]
    Gene: GPPS Small subunit
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9SBR4 (1-End)
      • expression tag (0)
  • Chain 'C':
    Compound: Geranyl diphosphate synthase small subunit
    Species: Mentha x piperita [TaxId:34256]
    Gene: GPPS Small subunit
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9SBR4 (1-End)
      • expression tag (0)
  • Chain 'D':
    Compound: Geranyl diphosphate synthase large subunit
    Species: Mentha x piperita [TaxId:34256]
    Gene: GPPS Large Subunit
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9SBR3 (1-294)
      • expression tag (0)
    Domains in SCOPe 2.06: d3krfd1, d3krfd2
  • Heterogens: PPV, MG, EDO, IPE, DST, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3krfA (A:)
    mfdfdgymlrkaksvnkaleaavqmkeplkihesmrysllaggkrvrpmlciaacelvgg
    destampaacavemihtmslmhddlpcmdnddlrrgkptnhmafgesvavlagdallsfa
    fehvaaatkgapperivrvlgelavsigseglvagqvvdvcsegmaevgldhlefihhhk
    taallqgsvvlgailgggkeeevaklrkfancigllfqvvddildvtksskelgktagkd
    lvadkttypkligvekskefadrlnreaqeqllhfhphraaplialanyiayrdn
    

    Sequence, based on observed residues (ATOM records): (download)
    >3krfA (A:)
    mfdfdgymlrkaksvnkaleaavqmkeplkihesmrysllaggkrvrpmlciaacelvgg
    destampaacavemihtmslmhddlpcmdnddlrrgkptnhmafgesvavlagdallsfa
    fehvaaatkgapperivrvlgelavsigseglvagqvvdvcsegmaevgldhlefihhhk
    taallqgsvvlgailgggkeeevaklrkfancigllfqvvddildvtkkttypkligvek
    skefadrlnreaqeqllhfhphraaplialanyiayrdn
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3krfD (D:)
    mfdfdgymlrkaksvnkaleaavqmkeplkihesmrysllaggkrvrpmlciaacelvgg
    destampaacavemihtmslmhddlpcmdnddlrrgkptnhmafgesvavlagdallsfa
    fehvaaatkgapperivrvlgelavsigseglvagqvvdvcsegmaevgldhlefihhhk
    taallqgsvvlgailgggkeeevaklrkfancigllfqvvddildvtksskelgktagkd
    lvadkttypkligvekskefadrlnreaqeqllhfhphraaplialanyiayrdn