PDB entry 3krd

View 3krd on RCSB PDB site
Description: Crystal Structure of Mycobacterium Tuberculosis Proteasome in complex with Fellutamide B
Class: hydrolase
Keywords: Binding Sites, Mycobacterium tuberculosis, Protein Subunits, Substrate Specificity, Hydrolase, Proteasome, Fellutamide B, inhibition, Protease, Threonine protease, Virulence, Autocatalytic cleavage, Zymogen
Deposited on 2009-11-18, released 2010-09-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-09-29, with a file datestamp of 2010-09-24.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.208
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain '1':
    Compound: Proteasome subunit alpha
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: MT2169, prcA, Rv2109c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3krd1_
  • Chain '2':
    Compound: Proteasome subunit beta
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: MT2170, prcB, Rv2110c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3krd2_
  • Chain 'A':
    Compound: Proteasome subunit alpha
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: MT2169, prcA, Rv2109c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3krda_
  • Chain 'B':
    Compound: Proteasome subunit alpha
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: MT2169, prcA, Rv2109c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3krdb_
  • Chain 'C':
    Compound: Proteasome subunit beta
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: MT2170, prcB, Rv2110c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3krdc_
  • Chain 'D':
    Compound: Proteasome subunit alpha
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: MT2169, prcA, Rv2109c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3krdd_
  • Chain 'E':
    Compound: Proteasome subunit beta
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: MT2170, prcB, Rv2110c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3krde_
  • Chain 'F':
    Compound: Proteasome subunit alpha
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: MT2169, prcA, Rv2109c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3krdf_
  • Chain 'G':
    Compound: Proteasome subunit beta
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: MT2170, prcB, Rv2110c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3krdg_
  • Chain 'H':
    Compound: Proteasome subunit beta
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: MT2170, prcB, Rv2110c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3krdh_
  • Chain 'I':
    Compound: Proteasome subunit alpha
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: MT2169, prcA, Rv2109c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3krdi_
  • Chain 'J':
    Compound: Proteasome subunit beta
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: MT2170, prcB, Rv2110c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3krdj_
  • Chain 'K':
    Compound: Proteasome subunit alpha
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: MT2169, prcA, Rv2109c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3krdk_
  • Chain 'L':
    Compound: Proteasome subunit beta
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: MT2170, prcB, Rv2110c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3krdl_
  • Chain 'M':
    Compound: Proteasome subunit alpha
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: MT2169, prcA, Rv2109c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3krdm_
  • Chain 'N':
    Compound: Proteasome subunit beta
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: MT2170, prcB, Rv2110c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3krdn_
  • Chain 'O':
    Compound: Proteasome subunit alpha
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: MT2169, prcA, Rv2109c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3krdo_
  • Chain 'P':
    Compound: Proteasome subunit beta
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: MT2170, prcB, Rv2110c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3krdp_
  • Chain 'Q':
    Compound: Proteasome subunit alpha
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: MT2169, prcA, Rv2109c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3krdq_
  • Chain 'R':
    Compound: Proteasome subunit beta
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: MT2170, prcB, Rv2110c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3krdr_
  • Chain 'S':
    Compound: Proteasome subunit alpha
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: MT2169, prcA, Rv2109c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3krds_
  • Chain 'T':
    Compound: Proteasome subunit beta
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: MT2170, prcB, Rv2110c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3krdt_
  • Chain 'U':
    Compound: Proteasome subunit alpha
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: MT2169, prcA, Rv2109c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3krdu_
  • Chain 'V':
    Compound: Proteasome subunit beta
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: MT2170, prcB, Rv2110c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3krdv_
  • Chain 'W':
    Compound: Proteasome subunit alpha
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: MT2169, prcA, Rv2109c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3krdw_
  • Chain 'X':
    Compound: Proteasome subunit beta
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: MT2170, prcB, Rv2110c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3krdx_
  • Chain 'Y':
    Compound: Proteasome subunit alpha
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: MT2169, prcA, Rv2109c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3krdy_
  • Chain 'Z':
    Compound: Proteasome subunit beta
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: MT2170, prcB, Rv2110c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3krdz_
  • Heterogens: FEB, HOH

PDB Chain Sequences:

  • Chain '1':
    Sequence, based on SEQRES records: (download)
    >3krd1 (1:)
    msfpyfispeqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrv
    gfaaagkfnefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyev
    elcvaevahygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltda
    lriavaalragsadtsggdqptlgvaslevavldanrprrafrritgsalqallvdqesp
    qsdgessg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3krd1 (1:)
    speqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrvgfaaagk
    fnefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyevelcvaev
    ahygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltdalriavaa
    lraggvaslevavldanrprrafrritgsalqall
    

  • Chain '2':
    Sequence, based on SEQRES records: (download)
    >3krd2 (2:)
    ttivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagri
    vsfdaaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsa
    tggpdlvrgifptaviidadgavdvpesriaelaraiiesrsgadtfgsdggekhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3krd2 (2:)
    ttivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagri
    vsfdaaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsa
    tggpdlvrgifptaviidadgavdvpesriaelaraiiesrs
    

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3krdA (A:)
    msfpyfispeqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrv
    gfaaagkfnefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyev
    elcvaevahygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltda
    lriavaalragsadtsggdqptlgvaslevavldanrprrafrritgsalqallvdqesp
    qsdgessg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3krdA (A:)
    speqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrvgfaaagk
    fnefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyevelcvaev
    ahygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltdalriavaa
    lragvaslevavldanrprrafrritgsalqall
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3krdB (B:)
    msfpyfispeqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrv
    gfaaagkfnefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyev
    elcvaevahygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltda
    lriavaalragsadtsggdqptlgvaslevavldanrprrafrritgsalqallvdqesp
    qsdgessg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3krdB (B:)
    speqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrvgfaaagk
    fnefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyevelcvaev
    ahygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltdalriavaa
    lragvaslevavldanrprrafrritgsalqal
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3krdC (C:)
    ttivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagri
    vsfdaaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsa
    tggpdlvrgifptaviidadgavdvpesriaelaraiiesrsgadtfgsdggekhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3krdC (C:)
    ttivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagri
    vsfdaaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsa
    tggpdlvrgifptaviidadgavdvpesriaelaraiiesrs
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3krdD (D:)
    msfpyfispeqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrv
    gfaaagkfnefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyev
    elcvaevahygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltda
    lriavaalragsadtsggdqptlgvaslevavldanrprrafrritgsalqallvdqesp
    qsdgessg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3krdD (D:)
    speqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrvgfaaagk
    fnefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyevelcvaev
    ahygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltdalriavaa
    lravaslevavldanrprrafrritgsalqall
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3krdE (E:)
    ttivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagri
    vsfdaaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsa
    tggpdlvrgifptaviidadgavdvpesriaelaraiiesrsgadtfgsdggekhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3krdE (E:)
    ttivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagri
    vsfdaaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsa
    tggpdlvrgifptaviidadgavdvpesriaelaraiiesrs
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3krdF (F:)
    msfpyfispeqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrv
    gfaaagkfnefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyev
    elcvaevahygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltda
    lriavaalragsadtsggdqptlgvaslevavldanrprrafrritgsalqallvdqesp
    qsdgessg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3krdF (F:)
    speqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrvgfaaagk
    fnefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyevelcvaev
    ahygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltdalriavaa
    lraggvaslevavldanrprrafrritgsalqallv
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >3krdG (G:)
    ttivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagri
    vsfdaaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsa
    tggpdlvrgifptaviidadgavdvpesriaelaraiiesrsgadtfgsdggekhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3krdG (G:)
    ttivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagri
    vsfdaaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsa
    tggpdlvrgifptaviidadgavdvpesriaelaraiiesrs
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >3krdH (H:)
    ttivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagri
    vsfdaaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsa
    tggpdlvrgifptaviidadgavdvpesriaelaraiiesrsgadtfgsdggekhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3krdH (H:)
    ttivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagri
    vsfdaaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsa
    tggpdlvrgifptaviidadgavdvpesriaelaraiiesrs
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >3krdI (I:)
    msfpyfispeqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrv
    gfaaagkfnefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyev
    elcvaevahygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltda
    lriavaalragsadtsggdqptlgvaslevavldanrprrafrritgsalqallvdqesp
    qsdgessg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3krdI (I:)
    speqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrvgfaaagk
    fnefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyevelcvaev
    ahygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltdalriavaa
    lraggvaslevavldanrprrafrritgsalqall
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >3krdJ (J:)
    ttivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagri
    vsfdaaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsa
    tggpdlvrgifptaviidadgavdvpesriaelaraiiesrsgadtfgsdggekhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3krdJ (J:)
    ttivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagri
    vsfdaaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsa
    tggpdlvrgifptaviidadgavdvpesriaelaraiiesrs
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >3krdK (K:)
    msfpyfispeqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrv
    gfaaagkfnefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyev
    elcvaevahygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltda
    lriavaalragsadtsggdqptlgvaslevavldanrprrafrritgsalqallvdqesp
    qsdgessg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3krdK (K:)
    speqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrvgfaaagk
    fnefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyevelcvaev
    ahygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltdalriavaa
    lraggvaslevavldanrprrafrritgsalqall
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >3krdL (L:)
    ttivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagri
    vsfdaaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsa
    tggpdlvrgifptaviidadgavdvpesriaelaraiiesrsgadtfgsdggekhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3krdL (L:)
    ttivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagri
    vsfdaaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsa
    tggpdlvrgifptaviidadgavdvpesriaelaraiiesrs
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >3krdM (M:)
    msfpyfispeqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrv
    gfaaagkfnefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyev
    elcvaevahygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltda
    lriavaalragsadtsggdqptlgvaslevavldanrprrafrritgsalqallvdqesp
    qsdgessg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3krdM (M:)
    speqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrvgfaaagk
    fnefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyevelcvaev
    ahygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltdalriavaa
    lragvaslevavldanrprrafrritgsalqall
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >3krdN (N:)
    ttivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagri
    vsfdaaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsa
    tggpdlvrgifptaviidadgavdvpesriaelaraiiesrsgadtfgsdggekhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3krdN (N:)
    ttivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagri
    vsfdaaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsa
    tggpdlvrgifptaviidadgavdvpesriaelaraiiesrs
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >3krdO (O:)
    msfpyfispeqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrv
    gfaaagkfnefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyev
    elcvaevahygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltda
    lriavaalragsadtsggdqptlgvaslevavldanrprrafrritgsalqallvdqesp
    qsdgessg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3krdO (O:)
    speqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrvgfaaagk
    fnefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyevelcvaev
    ahygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltdalriavaa
    lragvaslevavldanrprrafrritgsalqall
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >3krdP (P:)
    ttivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagri
    vsfdaaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsa
    tggpdlvrgifptaviidadgavdvpesriaelaraiiesrsgadtfgsdggekhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3krdP (P:)
    ttivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagri
    vsfdaaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsa
    tggpdlvrgifptaviidadgavdvpesriaelaraiiesrs
    

  • Chain 'Q':
    Sequence, based on SEQRES records: (download)
    >3krdQ (Q:)
    msfpyfispeqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrv
    gfaaagkfnefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyev
    elcvaevahygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltda
    lriavaalragsadtsggdqptlgvaslevavldanrprrafrritgsalqallvdqesp
    qsdgessg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3krdQ (Q:)
    speqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrvgfaaagk
    fnefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyevelcvaev
    ahygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltdalriavaa
    lragvaslevavldanrprrafrritgsalqall
    

  • Chain 'R':
    Sequence, based on SEQRES records: (download)
    >3krdR (R:)
    ttivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagri
    vsfdaaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsa
    tggpdlvrgifptaviidadgavdvpesriaelaraiiesrsgadtfgsdggekhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3krdR (R:)
    ttivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagri
    vsfdaaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsa
    tggpdlvrgifptaviidadgavdvpesriaelaraiiesrsgadtfgs
    

  • Chain 'S':
    Sequence, based on SEQRES records: (download)
    >3krdS (S:)
    msfpyfispeqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrv
    gfaaagkfnefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyev
    elcvaevahygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltda
    lriavaalragsadtsggdqptlgvaslevavldanrprrafrritgsalqallvdqesp
    qsdgessg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3krdS (S:)
    speqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrvgfaaagk
    fnefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyevelcvaev
    ahygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltdalriavaa
    lragvaslevavldanrprrafrritgsalqallv
    

  • Chain 'T':
    Sequence, based on SEQRES records: (download)
    >3krdT (T:)
    ttivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagri
    vsfdaaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsa
    tggpdlvrgifptaviidadgavdvpesriaelaraiiesrsgadtfgsdggekhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3krdT (T:)
    ttivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagri
    vsfdaaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsa
    tggpdlvrgifptaviidadgavdvpesriaelaraiiesrs
    

  • Chain 'U':
    Sequence, based on SEQRES records: (download)
    >3krdU (U:)
    msfpyfispeqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrv
    gfaaagkfnefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyev
    elcvaevahygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltda
    lriavaalragsadtsggdqptlgvaslevavldanrprrafrritgsalqallvdqesp
    qsdgessg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3krdU (U:)
    speqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrvgfaaagk
    fnefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyevelcvaev
    ahygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltdalriavaa
    lragvaslevavldanrprrafrritgsalqall
    

  • Chain 'V':
    Sequence, based on SEQRES records: (download)
    >3krdV (V:)
    ttivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagri
    vsfdaaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsa
    tggpdlvrgifptaviidadgavdvpesriaelaraiiesrsgadtfgsdggekhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3krdV (V:)
    ttivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagri
    vsfdaaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsa
    tggpdlvrgifptaviidadgavdvpesriaelaraiiesrsgadtfgs
    

  • Chain 'W':
    Sequence, based on SEQRES records: (download)
    >3krdW (W:)
    msfpyfispeqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrv
    gfaaagkfnefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyev
    elcvaevahygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltda
    lriavaalragsadtsggdqptlgvaslevavldanrprrafrritgsalqallvdqesp
    qsdgessg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3krdW (W:)
    speqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrvgfaaagk
    fnefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyevelcvaev
    ahygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltdalriavaa
    lraggvaslevavldanrprrafrritgsalqall
    

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >3krdX (X:)
    ttivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagri
    vsfdaaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsa
    tggpdlvrgifptaviidadgavdvpesriaelaraiiesrsgadtfgsdggekhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3krdX (X:)
    ttivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagri
    vsfdaaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsa
    tggpdlvrgifptaviidadgavdvpesriaelaraiiesrs
    

  • Chain 'Y':
    Sequence, based on SEQRES records: (download)
    >3krdY (Y:)
    msfpyfispeqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrv
    gfaaagkfnefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyev
    elcvaevahygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltda
    lriavaalragsadtsggdqptlgvaslevavldanrprrafrritgsalqallvdqesp
    qsdgessg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3krdY (Y:)
    speqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrvgfaaagk
    fnefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyevelcvaev
    ahygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltdalriavaa
    lraggvaslevavldanrprrafrritgsalqallv
    

  • Chain 'Z':
    Sequence, based on SEQRES records: (download)
    >3krdZ (Z:)
    ttivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagri
    vsfdaaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsa
    tggpdlvrgifptaviidadgavdvpesriaelaraiiesrsgadtfgsdggekhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3krdZ (Z:)
    ttivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagri
    vsfdaaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsa
    tggpdlvrgifptaviidadgavdvpesriaelaraiiesrs