PDB entry 3kqg

View 3kqg on RCSB PDB site
Description: Trimeric Structure of Langerin
Class: immune system
Keywords: trimer, neck and CRD, Coiled coil, Lectin, IMMUNE SYSTEM
Deposited on 2009-11-17, released 2010-02-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: C-type lectin domain family 4 member K
    Species: Homo sapiens [TaxId:9606]
    Gene: CD207, CLEC4K
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9UJ71
      • engineered (131)
    Domains in SCOPe 2.07: d3kqga1, d3kqga2
  • Chain 'B':
    Compound: C-type lectin domain family 4 member K
    Species: Homo sapiens [TaxId:9606]
    Gene: CD207, CLEC4K
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9UJ71
      • engineered (131)
    Domains in SCOPe 2.07: d3kqgb1, d3kqgb2
  • Chain 'C':
    Compound: C-type lectin domain family 4 member K
    Species: Homo sapiens [TaxId:9606]
    Gene: CD207, CLEC4K
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9UJ71
      • engineered (131)
    Domains in SCOPe 2.07: d3kqgc1, d3kqgc2
  • Chain 'D':
    Compound: C-type lectin domain family 4 member K
    Species: Homo sapiens [TaxId:9606]
    Gene: CD207, CLEC4K
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9UJ71
      • engineered (131)
    Domains in SCOPe 2.07: d3kqgd1, d3kqgd2
  • Chain 'E':
    Compound: C-type lectin domain family 4 member K
    Species: Homo sapiens [TaxId:9606]
    Gene: CD207, CLEC4K
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9UJ71
      • engineered (131)
    Domains in SCOPe 2.07: d3kqge1, d3kqge2
  • Chain 'F':
    Compound: C-type lectin domain family 4 member K
    Species: Homo sapiens [TaxId:9606]
    Gene: CD207, CLEC4K
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9UJ71
      • engineered (131)
    Domains in SCOPe 2.07: d3kqgf1, d3kqgf2
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3kqgA (A:)
    astlnaqipelksdlekasalntkiralqgslenmskllkrqndilqvvsqgwkyfkgnf
    yyfslipktwysaeqfcvsrnshltsvtseseqeflyktaggliywigltkagmegdwsw
    vddtpfnkvqsarfwipgepnnagnnehcgnikapslqawndapcdktflfickrpyvps
    ep
    

    Sequence, based on observed residues (ATOM records): (download)
    >3kqgA (A:)
    sdlekasalntkiralqgslenmskllkrqndilqvvsqgwkyfkgnfyyfslipktwys
    aeqfcvsrnshltsvtseseqeflyktaggliywigltkagmegdwswvddtpfnkvqsa
    rfwipgepnnagnnehcgnikapslqawndapcdktflfickrpyvpse
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3kqgB (B:)
    astlnaqipelksdlekasalntkiralqgslenmskllkrqndilqvvsqgwkyfkgnf
    yyfslipktwysaeqfcvsrnshltsvtseseqeflyktaggliywigltkagmegdwsw
    vddtpfnkvqsarfwipgepnnagnnehcgnikapslqawndapcdktflfickrpyvps
    ep
    

    Sequence, based on observed residues (ATOM records): (download)
    >3kqgB (B:)
    lntkiralqgslenmskllkrqndilqvvsqgwkyfkgnfyyfslipktwysaeqfcvsr
    nshltsvtseseqeflyktaggliywigltkaggdwswvddtpfnkvqsarfwipgepnn
    agnnehcgnikapslqawndapcdktflfickrpyvp
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3kqgC (C:)
    astlnaqipelksdlekasalntkiralqgslenmskllkrqndilqvvsqgwkyfkgnf
    yyfslipktwysaeqfcvsrnshltsvtseseqeflyktaggliywigltkagmegdwsw
    vddtpfnkvqsarfwipgepnnagnnehcgnikapslqawndapcdktflfickrpyvps
    ep
    

    Sequence, based on observed residues (ATOM records): (download)
    >3kqgC (C:)
    lntkiralqgslenmskllkrqndilqvvsqgwkyfkgnfyyfslipktwysaeqfcvsr
    nshltsvtseseqeflyktaggliywigltkagmegdwswvddtpfnkvqsarfwipgep
    nnagnnehcgnikapslqawndapcdktflfickrpyvp
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3kqgD (D:)
    astlnaqipelksdlekasalntkiralqgslenmskllkrqndilqvvsqgwkyfkgnf
    yyfslipktwysaeqfcvsrnshltsvtseseqeflyktaggliywigltkagmegdwsw
    vddtpfnkvqsarfwipgepnnagnnehcgnikapslqawndapcdktflfickrpyvps
    ep
    

    Sequence, based on observed residues (ATOM records): (download)
    >3kqgD (D:)
    alntkiralqgslenmskllkrqndilqvvsqgwkyfkgnfyyfslipktwysaeqfcvs
    rnshltsvtseseqeflyktaggliywigltkagdwswvddtpfnkvqsarfwipgepnn
    agnnehcgnikapslqawndapcdktflfickrpyvps
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3kqgE (E:)
    astlnaqipelksdlekasalntkiralqgslenmskllkrqndilqvvsqgwkyfkgnf
    yyfslipktwysaeqfcvsrnshltsvtseseqeflyktaggliywigltkagmegdwsw
    vddtpfnkvqsarfwipgepnnagnnehcgnikapslqawndapcdktflfickrpyvps
    ep
    

    Sequence, based on observed residues (ATOM records): (download)
    >3kqgE (E:)
    lntkiralqgslenmskllkrqndilqvvsqgwkyfkgnfyyfslipktwysaeqfcvsr
    nshltsvtseseqeflyktaggliywigltkagmegdwswvddtpfnkvqsarfwipgep
    nnagnnehcgnikapslqawndapcdktflfickrpyvps
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3kqgF (F:)
    astlnaqipelksdlekasalntkiralqgslenmskllkrqndilqvvsqgwkyfkgnf
    yyfslipktwysaeqfcvsrnshltsvtseseqeflyktaggliywigltkagmegdwsw
    vddtpfnkvqsarfwipgepnnagnnehcgnikapslqawndapcdktflfickrpyvps
    ep
    

    Sequence, based on observed residues (ATOM records): (download)
    >3kqgF (F:)
    salntkiralqgslenmskllkrqndilqvvsqgwkyfkgnfyyfslipktwysaeqfcv
    srnshltsvtseseqeflyktaggliywigltkagmegdwswvddtpfnkvqsarfwipg
    epnnagnnehcgnikapslqawndapcdktflfickrpyvps