PDB entry 3kne

View 3kne on RCSB PDB site
Description: Carbonic Anhydrase II H64C mutant in complex with an in situ formed triazole
Class: lyase
Keywords: 10 STRANDED; TWISTED BETA-SHEETS; LYASE; Acetylation, Metal-binding, click-chemistry, azide, alkyne, LYASE
Deposited on 2009-11-12, released 2011-05-18
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-05-18, with a file datestamp of 2011-05-13.
Experiment type: XRAY
Resolution: 1.35 Å
R-factor: 0.129
AEROSPACI score: 0.76 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Carbonic anhydrase 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00918 (Start-264)
      • engineered (68)
    Domains in SCOPe 2.06: d3knea_
  • Heterogens: ZN, BE7, DAW, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3kneA (A:)
    gspefmshhwgygkhngpehwhkdfpiakgerqspvdidthtakydpslkplsvsydqat
    slrilnngcafnvefddsqdkavlkggpldgtyrliqfhfhwgsldgqgsehtvdkkkya
    aelhlvhwntkygdfgkavqqpdglavlgiflkvgsakpglqkvvdvldsiktkgksadf
    tnfdprgllpesldywtypgslttppllecvtwivlkepisvsseqvlkfrklnfngege
    peelmvdnwrpaqplknrqikasfk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3kneA (A:)
    hwgygkhngpehwhkdfpiakgerqspvdidthtakydpslkplsvsydqatslrilnng
    cafnvefddsqdkavlkggpldgtyrliqfhfhwgsldgqgsehtvdkkkyaaelhlvhw
    ntkygdfgkavqqpdglavlgiflkvgsakpglqkvvdvldsiktkgksadftnfdprgl
    lpesldywtypgslttppllecvtwivlkepisvsseqvlkfrklnfngegepeelmvdn
    wrpaqplknrqikasfk