PDB entry 3kmg

View 3kmg on RCSB PDB site
Description: The X-ray Crystal Structure of PPAR-gamma in Complex with an Indole Derivative Modulator, GSK538, and an SRC-1 Peptide
Class: transcription
Keywords: PPAR-gamma, Peroxisome proliferator-activated receptor, Telmisartan, Diabetes, Modulator, Activator, Diabetes mellitus, Disease mutation, DNA-binding, Metal-binding, Nucleus, Obesity, Phosphoprotein, Receptor, Transcription, Transcription regulation, Zinc-finger
Deposited on 2009-11-10, released 2010-01-12
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.199
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peroxisome proliferator-activated receptor gamma
    Species: Homo sapiens [TaxId:9606]
    Gene: PPARG, NR1C3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d3kmga_
  • Chain 'B':
    Compound: steroid receptor coactivator-1
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 3KMG
  • Chain 'D':
    Compound: Peroxisome proliferator-activated receptor gamma
    Species: Homo sapiens [TaxId:9606]
    Gene: PPARG, NR1C3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d3kmgd_
  • Chain 'E':
    Compound: steroid receptor coactivator-1
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 3KMG
  • Heterogens: 538, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3kmgA (A:)
    pesadlralakhlydsyiksfpltkakarailtgkttdkspfviydmnslmmgedkikfk
    hitplqeqskevairifqgcqfrsveavqeiteyaksipgfvnldlndqvtllkygvhei
    iytmlaslmnkdgvlisegqgfmtreflkslrkpfgdfmepkfefavkfnalelddsdla
    ifiaviilsgdrpgllnvkpiediqdnllqalelqlklnhpessqlfakllqkmtdlrqi
    vtehvqllqvikktetdmslhpllqeiykdly
    

    Sequence, based on observed residues (ATOM records): (download)
    >3kmgA (A:)
    adlralakhlydsyiksfpltkakarailtgkttdkspfviydmnslmmgedkikeqske
    vairifqgcqfrsveavqeiteyaksipgfvnldlndqvtllkygvheiiytmlaslmnk
    dgvlisegqgfmtreflkslrkpfgdfmepkfefavkfnalelddsdlaifiaviilsgd
    rpgllnvkpiediqdnllqalelqlklnhpessqlfakllqkmtdlrqivtehvqllqvi
    kktetmslhpllqeiykdl
    

  • Chain 'B':
    No sequence available.

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3kmgD (D:)
    pesadlralakhlydsyiksfpltkakarailtgkttdkspfviydmnslmmgedkikfk
    hitplqeqskevairifqgcqfrsveavqeiteyaksipgfvnldlndqvtllkygvhei
    iytmlaslmnkdgvlisegqgfmtreflkslrkpfgdfmepkfefavkfnalelddsdla
    ifiaviilsgdrpgllnvkpiediqdnllqalelqlklnhpessqlfakllqkmtdlrqi
    vtehvqllqvikktetdmslhpllqeiykdly
    

    Sequence, based on observed residues (ATOM records): (download)
    >3kmgD (D:)
    sadlralakhlydsyiksfpltkakarailtgkttdkspfviydmnslmmgedkkevair
    ifqgcqfrsveavqeiteyaksipgfvnldlndqvtllkygvheiiytmlaslmnkdgvl
    isegqgfmtreflkslrkpfgdfmepkfefavkfnalelddsdlaifiaviilsgdrpgl
    lnvkpiediqdnllqalelqlklnhpessqlfakllqkmtdlrqivtehvqllqvikkte
    tdmslhpllqeiykdl
    

  • Chain 'E':
    No sequence available.