PDB entry 3kkt

View 3kkt on RCSB PDB site
Description: Crystal structure of human PDE4b with 5-[3-[(1S,2S,4R)-Bicyclo[2.2.1]hept-2-yloxy]-4-methoxyp henyl]tetrahydro-2(1H)-pyrimidinone reveals ordering of the C-terminal helix residues 502-509.
Class: hydrolase
Keywords: PHOSPHODIESTERASE, ALTERNATIVE SPLICING,HYDROLASE, Phosphoprotein, HYDROLASE
Deposited on 2009-11-06, released 2009-11-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.48 Å
R-factor: 0.238
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cAMP-specific 3',5'-cyclic phosphodiesterase 4B
    Species: Homo sapiens [TaxId:9606]
    Gene: DPDE4, PDE4B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3kkta_
  • Chain 'B':
    Compound: cAMP-specific 3',5'-cyclic phosphodiesterase 4B
    Species: Homo sapiens [TaxId:9606]
    Gene: DPDE4, PDE4B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3kktb_
  • Heterogens: ZN, 0CP, MG, B3P, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3kktA (A:)
    mgsshhhhhhssglvprgshmsisrfgvntenedhlakeledlnkwglnifnvagyshnr
    pltcimyaifqerdllktfrissdtfitymmtledhyhsdvayhnslhaadvaqsthvll
    stpaldavftdleilaaifaaaihdvdhpgvsnqflintnselalmyndesvlenhhlav
    gfkllqeehcdifmnltkkqrqtlrkmvidmvlatdmskhmslladlktmvetkkvtssg
    vllldnytdriqvlrnmvhcadlsnptkslelyrqwtdrimeeffqqgdkerergmeisp
    mcdkhtasveksqvgfidyivhplwetwadlvqpdaqdildtlednrnwyqsmipqspsp
    pldeqnrdcqglmekfqfeltldeedsegpekegeghs
    

    Sequence, based on observed residues (ATOM records): (download)
    >3kktA (A:)
    edhlakeledlnkwglnifnvagyshnrpltcimyaifqerdllktfrissdtfitymmt
    ledhyhsdvayhnslhaadvaqsthvllstpaldavftdleilaaifaaaihdvdhpgvs
    nqflintnselalmyndesvlenhhlavgfkllqeehcdifmnltkkqrqtlrkmvidmv
    latdmskhmslladlktmvetkkvtssgvllldnytdriqvlrnmvhcadlsnptkslel
    yrqwtdrimeeffqqgdkerergmeispmcdkhtasveksqvgfidyivhplwetwadlv
    qpdaqdildtlednrnwyqsmipqspsppldeqnrdcqglmekfqfe
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3kktB (B:)
    mgsshhhhhhssglvprgshmsisrfgvntenedhlakeledlnkwglnifnvagyshnr
    pltcimyaifqerdllktfrissdtfitymmtledhyhsdvayhnslhaadvaqsthvll
    stpaldavftdleilaaifaaaihdvdhpgvsnqflintnselalmyndesvlenhhlav
    gfkllqeehcdifmnltkkqrqtlrkmvidmvlatdmskhmslladlktmvetkkvtssg
    vllldnytdriqvlrnmvhcadlsnptkslelyrqwtdrimeeffqqgdkerergmeisp
    mcdkhtasveksqvgfidyivhplwetwadlvqpdaqdildtlednrnwyqsmipqspsp
    pldeqnrdcqglmekfqfeltldeedsegpekegeghs
    

    Sequence, based on observed residues (ATOM records): (download)
    >3kktB (B:)
    srfgvntenedhlakeledlnkwglnifnvagyshnrpltcimyaifqerdllktfriss
    dtfitymmtledhyhsdvayhnslhaadvaqsthvllstpaldavftdleilaaifaaai
    hdvdhpgvsnqflintnselalmyndesvlenhhlavgfkllqeehcdifmnltkkqrqt
    lrkmvidmvlatdmskhmslladlktmvetkkvtssgvllldnytdriqvlrnmvhcadl
    snptkslelyrqwtdrimeeffqqgdkerergmeispmcdkveksqvgfidyivhplwet
    wadlvqpdaqdildtlednrnwyqsmcqglmekfqfel