PDB entry 3kkm

View 3kkm on RCSB PDB site
Description: Crystal structure of H-Ras T35S in complex with GppNHp
Class: signaling protein
Keywords: GTP-binding, GTPase, SIGNALING PROTEIN
Deposited on 2009-11-06, released 2010-06-16
The last revision prior to the SCOPe 2.04 freeze date was dated 2014-02-12, with a file datestamp of 2014-02-07.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.197
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: gtpase hras
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01112 (6-171)
      • engineered mutation (40)
    Domains in SCOPe 2.04: d3kkma_
  • Heterogens: GNP, MG, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3kkmA (A:)
    gplgsdmteyklvvvgaggvgksaltiqliqnhfvdeydpsiedsyrkqvvidgetclld
    ildtagqeeysamrdqymrtgegflcvfainntksfedihqyreqikrvkdsddvpmvlv
    gnkcdlaartvesrqaqdlarsygipyietsaktrqgvedafytlvreirqh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3kkmA (A:)
    mteyklvvvgaggvgksaltiqliqnhfvdeydpsiedsyrkqvvidgetclldildtag
    mrtgegflcvfainntksfedihqyreqikrvkdsddvpmvlvgnkcdlaartvesrqaq
    dlarsygipyietsaktrqgvedafytlvreirqh