PDB entry 3kjd

View 3kjd on RCSB PDB site
Description: Human poly(ADP-ribose) polymerase 2, catalytic fragment in complex with an inhibitor ABT-888
Class: transferase
Keywords: transferase, enzyme-inhibitor complex, catalytic fragment, structural genomics, structural genomics consortium, sgc, glycosyltransferase, nad, nucleus, DNA-binding
Deposited on 2009-11-03, released 2009-11-17
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.182
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Poly [ADP-ribose] polymerase 2
    Species: Homo sapiens [TaxId:9606]
    Gene: ADPRT2, ADPRTL2, PARP2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9UGN5 (23-367)
      • expression tag (14-22)
      • see remark 999 (235)
    Domains in SCOPe 2.06: d3kjda1, d3kjda2, d3kjda3
  • Chain 'B':
    Compound: Poly [ADP-ribose] polymerase 2
    Species: Homo sapiens [TaxId:9606]
    Gene: ADPRT2, ADPRTL2, PARP2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9UGN5 (23-367)
      • expression tag (11-22)
      • see remark 999 (235)
    Domains in SCOPe 2.06: d3kjdb1, d3kjdb2, d3kjdb3
  • Heterogens: 78P, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3kjdA (A:)
    mhhhhhhssgvdlgtenlyfqsmdlrvqeliklicnvqameemmmemkyntkkaplgklt
    vaqikagyqslkkiedciragqhgralmeacnefytriphdfglrtpplirtqkelseki
    qllealgdieiaiklvktelqspehpldqhyrnlhcalrpldhesyefkvisqylqstha
    pthsdytmtlldlfevekdgekeafredlhnrmllwhgsrmsnwvgilshglriahpeap
    itgymfgkgiyfadmssksanycfasrlkntgllllsevalgqcnelleanpkaegllqg
    khstkglgkmapssahfvtlngstvplgpasdtgilnpdgytlnyneyivynpnqvrmry
    llkvqfnf
    

    Sequence, based on observed residues (ATOM records): (download)
    >3kjdA (A:)
    tenlyfqsmdlrvqeliklicnvqameemmmemkyntkkaplgkltvaqikagyqslkki
    edciragqhgralmeacnefytriphdfglrtpplirtqkelsekiqllealgdieiaik
    lvkspehpldqhyrnlhcalrpldhesyefkvisqylqsthapthsdytmtlldlfevek
    dgekeafredlhnrmllwhgsrmsnwvgilshglriahpeapitgymfgkgiyfadmssk
    sanycfasrlkntgllllsevalgqcnelleanpkaegllqgkhstkglgkmapssahfv
    tlngstvplgpasdtgilnpdgytlnyneyivynpnqvrmryllkvqfnf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3kjdB (B:)
    mhhhhhhssgvdlgtenlyfqsmdlrvqeliklicnvqameemmmemkyntkkaplgklt
    vaqikagyqslkkiedciragqhgralmeacnefytriphdfglrtpplirtqkelseki
    qllealgdieiaiklvktelqspehpldqhyrnlhcalrpldhesyefkvisqylqstha
    pthsdytmtlldlfevekdgekeafredlhnrmllwhgsrmsnwvgilshglriahpeap
    itgymfgkgiyfadmssksanycfasrlkntgllllsevalgqcnelleanpkaegllqg
    khstkglgkmapssahfvtlngstvplgpasdtgilnpdgytlnyneyivynpnqvrmry
    llkvqfnf
    

    Sequence, based on observed residues (ATOM records): (download)
    >3kjdB (B:)
    dlgtenlyfqsmdlrvqeliklicnvqameemmmemkyntkkaplgkltvaqikagyqsl
    kkiedciragqhgralmeacnefytriphdfglrtpplirtqkelsekiqllealgdiei
    aiklvktelqspehpldqhyrnlhcalrpldhesyefkvisqylqsthapthsdytmtll
    dlfevekdgekeafredlhnrmllwhgsrmsnwvgilshglriahpeapitgymfgkgiy
    fadmssksanycfasrlkntgllllsevalgqcnelleanpkaegllqgkhstkglgkma
    pssahfvtlngstvplgpasdtgiytlnyneyivynpnqvrmryllkvqfnf