PDB entry 3kig

View 3kig on RCSB PDB site
Description: Mutant carbonic anhydrase II in complex with an azide and an alkyne
Class: lyase
Keywords: 10 STRANDED, TWISTED BETA-SHEETS, LYASE, Disease mutation, Metal-binding
Deposited on 2009-11-02, released 2010-11-17
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-05-18, with a file datestamp of 2011-05-13.
Experiment type: XRAY
Resolution: 1.39 Å
R-factor: 0.135
AEROSPACI score: 0.73 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Carbonic anhydrase 2
    Species: Homo sapiens [TaxId:9606]
    Gene: CA2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00918
      • engineered (68)
    Domains in SCOPe 2.03: d3kiga_
  • Heterogens: ZN, DA9, DA4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3kigA (A:)
    gspefmshhwgygkhngpehwhkdfpiakgerqspvdidthtakydpslkplsvsydqat
    slrilnngcafnvefddsqdkavlkggpldgtyrliqfhfhwgsldgqgsehtvdkkkya
    aelhlvhwntkygdfgkavqqpdglavlgiflkvgsakpglqkvvdvldsiktkgksadf
    tnfdprgllpesldywtypgslttppllecvtwivlkepisvsseqvlkfrklnfngege
    peelmvdnwrpaqplknrqikasfk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3kigA (A:)
    hhwgygkhngpehwhkdfpiakgerqspvdidthtakydpslkplsvsydqatslrilnn
    gcafnvefddsqdkavlkggpldgtyrliqfhfhwgsldgqgsehtvdkkkyaaelhlvh
    wntkygdfgkavqqpdglavlgiflkvgsakpglqkvvdvldsiktkgksadftnfdprg
    llpesldywtypgslttppllecvtwivlkepisvsseqvlkfrklnfngegepeelmvd
    nwrpaqplknrqikasf