PDB entry 3kht

View 3kht on RCSB PDB site
Description: Crystal structure of response regulator from Hahella chejuensis
Class: signaling protein
Keywords: Response regulator, PSI-II, 11023k, Structural Genomics, Protein Structure Initiative, New York SGX Research Center for Structural Genomics, NYSGXRC, DNA-binding, SIGNALING PROTEIN
Deposited on 2009-10-30, released 2009-11-10
The last revision prior to the SCOPe 2.08 freeze date was dated 2021-02-10, with a file datestamp of 2021-02-05.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Response regulator
    Species: Hahella chejuensis [TaxId:349521]
    Gene: HCH_02875
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3khta_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3khtA (A:)
    mslrskrvlvvednpddialirrvldrkdihcqlefvdngakalyqvqqakydliildig
    lpiangfevmsavrkpganqhtpiviltdnvsddrakqcmaagassvvdkssnnvtdfyg
    riyaifsywltvnhcqeghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3khtA (A:)
    skrvlvvednpddialirrvldrkdihcqlefvdngakalyqvqqakydliildiglpia
    ngfevmsavrkpganqhtpiviltdnvsddrakqcmaagassvvdkssnnvtdfygriya
    ifsywltvnhcq