PDB entry 3khq

View 3khq on RCSB PDB site
Description: Crystal structure of murine Ig-beta (CD79b) in the monomeric form
Class: protein binding
Keywords: CD79b, CD79a, Ig-beta, BCR, Ig domain, V-set, Immunoglobulin domain, PROTEIN BINDING
Deposited on 2009-10-30, released 2010-08-25
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-12-14, with a file datestamp of 2011-12-09.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.188
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: B-cell antigen receptor complex-associated protein beta chain
    Species: Mus musculus [TaxId:10090]
    Gene: Cd79b, Igb
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3khqa_
  • Heterogens: MG, FLC, GSH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3khqA (A:)
    pamtssdlplnfqgspcsqiwqhprfaakkrssmvkfhcytnhsgaltwfrkrgsqqpqe
    lvseegrivqtqngsvytltiqniqyedngiyfckqkcdsanhnvtdscgtellvlgfst
    ldqlkrrntlkdg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3khqA (A:)
    csqiwqhprfaakkrssmvkfhcytnhsgaltwfrkrgsqqpqelvseegrivqtqngsv
    ytltiqniqyedngiyfckqkcdsscgtellvl