PDB entry 3kho

View 3kho on RCSB PDB site
Description: Crystal structure of murine Ig-beta (CD79b) homodimer
Class: protein binding
Keywords: CD79b, CD79a, Ig-beta, BCR, Ig domain, V-set, Immunoglobulin domain, PROTEIN BINDING
Deposited on 2009-10-30, released 2010-08-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-08-25, with a file datestamp of 2010-08-20.
Experiment type: XRAY
Resolution: 3.11 Å
R-factor: 0.206
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: B-cell antigen receptor complex-associated protein beta chain
    Species: Mus musculus [TaxId:10090]
    Gene: Cd79b, Igb
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3khoa_
  • Chain 'B':
    Compound: B-cell antigen receptor complex-associated protein beta chain
    Species: Mus musculus [TaxId:10090]
    Gene: Cd79b, Igb
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3khob_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3khoA (A:)
    pamtssdlplnfqgspcsqiwqhprfaakkrssmvkfhcytnhsgaltwfrkrgsqqpqe
    lvseegrivqtqngsvytltiqniqyedngiyfckqkcdsanhnvtdscgtellvlgfst
    ldqlkrrntlkdg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3khoA (A:)
    iwqhprfaakkrssmvkfhcytnhsgaltwfrkrgsqqpqelvsgrivqtqngsvytlti
    qniqyedngiyfckqkdscgtellvlgf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3khoB (B:)
    pamtssdlplnfqgspcsqiwqhprfaakkrssmvkfhcytnhsgaltwfrkrgsqqpqe
    lvseegrivqtqngsvytltiqniqyedngiyfckqkcdsanhnvtdscgtellvlgfst
    ldqlkrrntlkdg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3khoB (B:)
    csqiwqhprfaakkrssmvkfhcytnhsgaltwfrkrgsqqpqelvseegrivqtqngsv
    ytltiqniqyedngiyfckqkcnvtdscgtellvl