PDB entry 3kft

View 3kft on RCSB PDB site
Description: Crystal structure of Pentaerythritol Tetranitrate Reductase complex with 1,4,5,6-tetrahydro NADH
Class: oxidoreductase
Keywords: NADH:flavin oxidoreductase / NADH oxidase family
Deposited on 2009-10-28, released 2010-02-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-02-02, with a file datestamp of 2010-01-29.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.166
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Pentaerythritol tetranitrate reductase
    Species: Enterobacter cloacae [TaxId:550]
    Gene: onr
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3kfta_
  • Chain 'B':
    Compound: Pentaerythritol tetranitrate reductase
    Species: Enterobacter cloacae [TaxId:550]
    Gene: onr
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3kftb_
  • Heterogens: FMN, NAD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3kftA (A:)
    saeklftplkvgavtapnrvfmapltrlrsiepgdiptplmgeyyrqrasagliiseatq
    isaqakgyagapglhspeqiaawkkitagvhaedgriavqlwhtgrishssiqpggqapv
    sasalnantrtslrdengnairvdtttpraleldeipgivndfrqavanareagfdlvel
    hsahgyllhqflspssnqrtdqyggsvenrarlvlevvdavcnewsadrigirvspigtf
    qnvdngpneeadalylieelakrgiaylhmsetdlaggkpyseafrqkvrerfhgviiga
    gaytaekaedligkglidavafgrdyianpdlvarlqkkaelnpqrpesfygggaegytd
    ypsl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3kftA (A:)
    eklftplkvgavtapnrvfmapltrlrsiepgdiptplmgeyyrqrasagliiseatqis
    aqakgyagapglhspeqiaawkkitagvhaedgriavqlwhtgrishssiqpggqapvsa
    salnantrtslrdengnairvdtttpraleldeipgivndfrqavanareagfdlvelhs
    ahgyllhqflspssnqrtdqyggsvenrarlvlevvdavcnewsadrigirvspigtfqn
    vdngpneeadalylieelakrgiaylhmsetgkpyseafrqkvrerfhgviigagaytae
    kaedligkglidavafgrdyianpdlvarlqkkaelnpqrpesfygggaegytdypsl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3kftB (B:)
    saeklftplkvgavtapnrvfmapltrlrsiepgdiptplmgeyyrqrasagliiseatq
    isaqakgyagapglhspeqiaawkkitagvhaedgriavqlwhtgrishssiqpggqapv
    sasalnantrtslrdengnairvdtttpraleldeipgivndfrqavanareagfdlvel
    hsahgyllhqflspssnqrtdqyggsvenrarlvlevvdavcnewsadrigirvspigtf
    qnvdngpneeadalylieelakrgiaylhmsetdlaggkpyseafrqkvrerfhgviiga
    gaytaekaedligkglidavafgrdyianpdlvarlqkkaelnpqrpesfygggaegytd
    ypsl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3kftB (B:)
    eklftplkvgavtapnrvfmapltrlrsiepgdiptplmgeyyrqrasagliiseatqis
    aqakgyagapglhspeqiaawkkitagvhaedgriavqlwhtgrishssiqpggqapvsa
    salnantrtslrdengnairvdtttpraleldeipgivndfrqavanareagfdlvelhs
    ahgyllhqflspssnqrtdqyggsvenrarlvlevvdavcnewsadrigirvspigtfqn
    vdngpneeadalylieelakrgiaylhmsetdkpyseafrqkvrerfhgviigagaytae
    kaedligkglidavafgrdyianpdlvarlqkkaelnpqrpesfygggaegytdypsl