PDB entry 3kfp

View 3kfp on RCSB PDB site
Description: HIV Protease (PR) with inhibitor TL-3 bound, and DMSOs in exo site
Class: hydrolase/hydrolase inhibitor
Keywords: HIV-1, PROTEASE, EXO SITE, Aspartyl protease, HYDROLASE-HYDROLASE INHIBITOR COMPLEX
Deposited on 2009-10-27, released 2010-02-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.77 Å
R-factor: 0.23
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protease
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q903N5 (0-98)
      • engineered (6)
    Domains in SCOPe 2.07: d3kfpa_
  • Heterogens: 3TL, DMS, BME, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3kfpA (A:)
    pqitlwkrplvtikiggqlkealldtgaddtvleemnlpgrwkpkmiggiggfikvrqyd
    qilieicghkaigtvlvgptpvniigrnlltqigctlnf