PDB entry 3kfc

View 3kfc on RCSB PDB site
Description: Complex Structure of LXR with an agonist
Class: transcription
Keywords: Nuclear Receptor, LXR, Liver X receptor, LXR agonist, LXR ligand, DNA-binding, Metal-binding, Nucleus, Receptor, Transcription, Transcription regulation, Zinc-finger
Deposited on 2009-10-27, released 2009-12-08
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.24
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: oxysterols receptor lxr-beta
    Species: Homo sapiens [TaxId:9606]
    Gene: NR1H2, LXRB, NER, UNR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3kfca_
  • Chain 'B':
    Compound: oxysterols receptor lxr-beta
    Species: Homo sapiens [TaxId:9606]
    Gene: NR1H2, LXRB, NER, UNR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3kfcb_
  • Chain 'C':
    Compound: oxysterols receptor lxr-beta
    Species: Homo sapiens [TaxId:9606]
    Gene: NR1H2, LXRB, NER, UNR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3kfcc_
  • Chain 'D':
    Compound: oxysterols receptor lxr-beta
    Species: Homo sapiens [TaxId:9606]
    Gene: NR1H2, LXRB, NER, UNR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3kfcd_
  • Heterogens: 61X, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3kfcA (A:)
    gshmgegegvqltaaqelmiqqlvaaqlqcnkrsfsdqpkvtpwplgadpqsrdarqqrf
    ahftelaiisvqeivdfakqvpgflqlgredqiallkastieimlletarrynhetecit
    flkdftyskddfhraglqvefinpifefsramrrlglddaeyalliainifsadrpnvqe
    pgrvealqqpyveallsytrikrpqdqlrfprmlmklvslrtlssvhseqvfalrlqdkk
    lppllseiwdvhe
    

    Sequence, based on observed residues (ATOM records): (download)
    >3kfcA (A:)
    ltaaqelmiqqlvaaqlqcnkrsfsdqpkvtpwplgdarqqrfahftelaiisvqeivdf
    akqvpgflqlgredqiallkastieimlletarrynhetecitflkdftyskddfhragl
    qvefinpifefsramrrlglddaeyalliainifsadrpnvqepgrvealqqpyvealls
    ytrikrpqdqlrfprmlmklvslrtlssvhseqvfalrlqdkklppllseiwd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3kfcB (B:)
    gshmgegegvqltaaqelmiqqlvaaqlqcnkrsfsdqpkvtpwplgadpqsrdarqqrf
    ahftelaiisvqeivdfakqvpgflqlgredqiallkastieimlletarrynhetecit
    flkdftyskddfhraglqvefinpifefsramrrlglddaeyalliainifsadrpnvqe
    pgrvealqqpyveallsytrikrpqdqlrfprmlmklvslrtlssvhseqvfalrlqdkk
    lppllseiwdvhe
    

    Sequence, based on observed residues (ATOM records): (download)
    >3kfcB (B:)
    qltaaqelmiqqlvaaqlqcnkrsfsdqpkvtpwpdarqqrfahftelaiisvqeivdfa
    kqvpgflqlgredqiallkastieimlletarrynhetecitflkdftyskddfhraglq
    vefinpifefsramrrlglddaeyalliainifsadrpnvqepgrvealqqpyveallsy
    trikrpqdqlrfprmlmklvslrtlssvhseqvfalrlqdkklppllseiwd
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3kfcC (C:)
    gshmgegegvqltaaqelmiqqlvaaqlqcnkrsfsdqpkvtpwplgadpqsrdarqqrf
    ahftelaiisvqeivdfakqvpgflqlgredqiallkastieimlletarrynhetecit
    flkdftyskddfhraglqvefinpifefsramrrlglddaeyalliainifsadrpnvqe
    pgrvealqqpyveallsytrikrpqdqlrfprmlmklvslrtlssvhseqvfalrlqdkk
    lppllseiwdvhe
    

    Sequence, based on observed residues (ATOM records): (download)
    >3kfcC (C:)
    ltaaqelmiqqlvaaqlqcnkrsfahftelaiisvqeivdfakqvpgflqlgredqiall
    kastieimlletarrynhetecitflkdftyskddfinpifefsramrrlglddaeyall
    iainifsadrpnvqepgrvealqqpyveallsytrikrpqdqlrfprmlmklvslrtlss
    vhseqv
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3kfcD (D:)
    gshmgegegvqltaaqelmiqqlvaaqlqcnkrsfsdqpkvtpwplgadpqsrdarqqrf
    ahftelaiisvqeivdfakqvpgflqlgredqiallkastieimlletarrynhetecit
    flkdftyskddfhraglqvefinpifefsramrrlglddaeyalliainifsadrpnvqe
    pgrvealqqpyveallsytrikrpqdqlrfprmlmklvslrtlssvhseqvfalrlqdkk
    lppllseiwdvhe
    

    Sequence, based on observed residues (ATOM records): (download)
    >3kfcD (D:)
    ltaaqelmiqqlvaaqlqcnkrsfsdqpkvtpwplgdarqqrfahftelaiisvqeivdf
    akqvpgflqlgredqiallkastieimlletarrynhetecitflkdftyskddfhragl
    qvefinpifefsramrrlglddaeyalliainifsadrpnvqepgrvealqqpyvealls
    ytrikrpqdqlrfprmlmklvslrtlssvhseqvfalrlqdkklppllseiwd