PDB entry 3keo

View 3keo on RCSB PDB site
Description: Crystal Structure of a Rex-family transcriptional regulatory protein from Streptococcus agalactiae complexed with NAD+
Class: transcription
Keywords: DNA binding protein, winged helix, Rossmann fold, NAD+, Repressor, Transcription, Transcription regulation, Redox sensing
Deposited on 2009-10-26, released 2010-11-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-11-10, with a file datestamp of 2010-11-05.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.178
AEROSPACI score: 0.64 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Redox-sensing transcriptional repressor rex
    Species: Streptococcus agalactiae serogroup III [TaxId:216495]
    Gene: gbs1167, rex
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3keoa1, d3keoa2
  • Chain 'B':
    Compound: Redox-sensing transcriptional repressor rex
    Species: Streptococcus agalactiae serogroup III [TaxId:216495]
    Gene: gbs1167, rex
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3keob1, d3keob2
  • Heterogens: NAD, MG, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3keoA (A:)
    mimdksipkatakrlslyyrifkrfntdgiekasskqiadalgidsatvrrdfsyfgelg
    rrgfgydvkklmnffaeilndhsttnvmlvgcgnigrallhyrfhdrnkmqismafdlds
    ndlvgkttedgipvygistindhlidsdietailtvpsteaqevadilvkagikgilsfs
    pvhltlpkdiivqyvdltselqtllyfmnqqr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3keoA (A:)
    sipkatakrlslyyrifkrfntdgiekasskqiadalgidsatvrrdfsyfgelgrrgfg
    ydvkklmnffaeilndhsttnvmlvgcgnigrallhyrfhdrnkmqismafdldsndlvg
    kttedgipvygistindhldsdietailtvpsteaqevadilvkagikgilsfspvhltl
    pkdiivqyvdltselqtllyfmnqqr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3keoB (B:)
    mimdksipkatakrlslyyrifkrfntdgiekasskqiadalgidsatvrrdfsyfgelg
    rrgfgydvkklmnffaeilndhsttnvmlvgcgnigrallhyrfhdrnkmqismafdlds
    ndlvgkttedgipvygistindhlidsdietailtvpsteaqevadilvkagikgilsfs
    pvhltlpkdiivqyvdltselqtllyfmnqqr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3keoB (B:)
    sipkatakrlslyyrifkrfntdgiekasskqiadalgidsatvrrdfsyfgelgrrgfg
    ydvkklmnffaeilndhsttnvmlvgcgnigrallhyrfhdrnkmqismafdldsndlvg
    kttedgipvygistindhlidsdietailtvpsteaqevadilvkagikgilsfspvhlt
    lpkdiivqyvdltselqtllyfmnqqr