PDB entry 3kdb

View 3kdb on RCSB PDB site
Description: Crystal Structure of HIV-1 Protease (Q7K, L33I, L63I) in Complex with KNI-10006
Class: hydrolase/hydrolase inhibitor
Keywords: VIRAL PROTEIN, Hydrolase, Protease, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 2009-10-22, released 2010-03-02
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.66 Å
R-factor: 0.214
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protease
    Species: Human immunodeficiency virus type 1 [TaxId:11686]
    Gene: gag-pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03367 (0-98)
      • engineered (6)
      • engineered (32)
      • engineered (62)
    Domains in SCOPe 2.06: d3kdba_
  • Chain 'B':
    Compound: Protease
    Species: Human immunodeficiency virus type 1 [TaxId:11686]
    Gene: gag-pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03367 (0-98)
      • engineered (6)
      • engineered (32)
      • engineered (62)
    Domains in SCOPe 2.06: d3kdbb_
  • Heterogens: GOL, 006, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3kdbA (A:)
    pqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggiggfikvrqyd
    qiiieicghkaigtvlvgptpvniigrnlltqigctlnf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3kdbB (B:)
    pqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggiggfikvrqyd
    qiiieicghkaigtvlvgptpvniigrnlltqigctlnf