PDB entry 3kda

View 3kda on RCSB PDB site
Description: Crystal structure of the CFTR inhibitory factor Cif with the H269A mutation
Class: hydrolase
Keywords: Alpha/beta hydrolase, Hydrolase
Deposited on 2009-10-22, released 2010-01-26
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-10-12, with a file datestamp of 2011-10-07.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.17
AEROSPACI score: 0.64 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: CFTR inhibitory factor (Cif)
    Species: Pseudomonas aeruginosa UCBPP-PA14 [TaxId:208963]
    Gene: PA14_26090
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q02P97 (0-294)
      • engineered (244)
      • expression tag (295-297)
    Domains in SCOPe 2.06: d3kdaa1, d3kdaa2
  • Chain 'B':
    Compound: CFTR inhibitory factor (Cif)
    Species: Pseudomonas aeruginosa UCBPP-PA14 [TaxId:208963]
    Gene: PA14_26090
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q02P97 (0-294)
      • engineered (244)
      • expression tag (295-297)
    Domains in SCOPe 2.06: d3kdab1, d3kdab2
  • Chain 'C':
    Compound: CFTR inhibitory factor (Cif)
    Species: Pseudomonas aeruginosa UCBPP-PA14 [TaxId:208963]
    Gene: PA14_26090
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q02P97 (0-294)
      • engineered (244)
      • expression tag (295-297)
    Domains in SCOPe 2.06: d3kdac1, d3kdac2
  • Chain 'D':
    Compound: CFTR inhibitory factor (Cif)
    Species: Pseudomonas aeruginosa UCBPP-PA14 [TaxId:208963]
    Gene: PA14_26090
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q02P97 (0-294)
      • engineered (244)
      • expression tag (295-297)
    Domains in SCOPe 2.06: d3kdad1, d3kdad2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3kdaA (A:)
    aeefpvpngfesayrevdgvklhyvkggqgplvmlvhgfgqtwyewhqlmpelakrftvi
    apdlpglgqseppktgysgeqvavylhklarqfspdrpfdlvahdigiwntypmvvknqa
    diarlvymeapipdariyrfpaftaqgeslvwhfsffaaddrlaetliagkerfflehfi
    kshasntevfserlldlyarsyakphslnasfeyyralnesvrqnaelaktrlqmptmtl
    agggaggmgtfqleqmkayaedveghvlpgcghwlpeecaapmnrlvidflsrgrhhhhh
    h
    

    Sequence, based on observed residues (ATOM records): (download)
    >3kdaA (A:)
    aeefpvpngfesayrevdgvklhyvkggqgplvmlvhgfgqtwyewhqlmpelakrftvi
    apdlpglgqseppktgysgeqvavylhklarqfspdrpfdlvahdigiwntypmvvknqa
    diarlvymeapipdariyrfpaftaqgeslvwhfsffaaddrlaetliagkerfflehfi
    kshasntevfserlldlyarsyakphslnasfeyyralnesvrqnaelaktrlqmptmtl
    agggaggmgtfqleqmkayaedveghvlpgcghwlpeecaapmnrlvidflsrgrhhh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3kdaB (B:)
    aeefpvpngfesayrevdgvklhyvkggqgplvmlvhgfgqtwyewhqlmpelakrftvi
    apdlpglgqseppktgysgeqvavylhklarqfspdrpfdlvahdigiwntypmvvknqa
    diarlvymeapipdariyrfpaftaqgeslvwhfsffaaddrlaetliagkerfflehfi
    kshasntevfserlldlyarsyakphslnasfeyyralnesvrqnaelaktrlqmptmtl
    agggaggmgtfqleqmkayaedveghvlpgcghwlpeecaapmnrlvidflsrgrhhhhh
    h
    

    Sequence, based on observed residues (ATOM records): (download)
    >3kdaB (B:)
    aeefpvpngfesayrevdgvklhyvkggqgplvmlvhgfgqtwyewhqlmpelakrftvi
    apdlpglgqseppktgysgeqvavylhklarqfspdrpfdlvahdigiwntypmvvknqa
    diarlvymeapipdariyrfpaftaqgeslvwhfsffaaddrlaetliagkerfflehfi
    kshasntevfserlldlyarsyakphslnasfeyyralnesvrqnaelaktrlqmptmtl
    agggaggmgtfqleqmkayaedveghvlpgcghwlpeecaapmnrlvidflsrgrhhh
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3kdaC (C:)
    aeefpvpngfesayrevdgvklhyvkggqgplvmlvhgfgqtwyewhqlmpelakrftvi
    apdlpglgqseppktgysgeqvavylhklarqfspdrpfdlvahdigiwntypmvvknqa
    diarlvymeapipdariyrfpaftaqgeslvwhfsffaaddrlaetliagkerfflehfi
    kshasntevfserlldlyarsyakphslnasfeyyralnesvrqnaelaktrlqmptmtl
    agggaggmgtfqleqmkayaedveghvlpgcghwlpeecaapmnrlvidflsrgrhhhhh
    h
    

    Sequence, based on observed residues (ATOM records): (download)
    >3kdaC (C:)
    aeefpvpngfesayrevdgvklhyvkggqgplvmlvhgfgqtwyewhqlmpelakrftvi
    apdlpglgqseppktgysgeqvavylhklarqfspdrpfdlvahdigiwntypmvvknqa
    diarlvymeapipdariyrfpaftaqgeslvwhfsffaaddrlaetliagkerfflehfi
    kshasntevfserlldlyarsyakphslnasfeyyralnesvrqnaelaktrlqmptmtl
    agggaggmgtfqleqmkayaedveghvlpgcghwlpeecaapmnrlvidflsrgrhhh
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3kdaD (D:)
    aeefpvpngfesayrevdgvklhyvkggqgplvmlvhgfgqtwyewhqlmpelakrftvi
    apdlpglgqseppktgysgeqvavylhklarqfspdrpfdlvahdigiwntypmvvknqa
    diarlvymeapipdariyrfpaftaqgeslvwhfsffaaddrlaetliagkerfflehfi
    kshasntevfserlldlyarsyakphslnasfeyyralnesvrqnaelaktrlqmptmtl
    agggaggmgtfqleqmkayaedveghvlpgcghwlpeecaapmnrlvidflsrgrhhhhh
    h
    

    Sequence, based on observed residues (ATOM records): (download)
    >3kdaD (D:)
    aeefpvpngfesayrevdgvklhyvkggqgplvmlvhgfgqtwyewhqlmpelakrftvi
    apdlpglgqseppktgysgeqvavylhklarqfspdrpfdlvahdigiwntypmvvknqa
    diarlvymeapipdariyrfpaftaqgeslvwhfsffaaddrlaetliagkerfflehfi
    kshasntevfserlldlyarsyakphslnasfeyyralnesvrqnaelaktrlqmptmtl
    agggaggmgtfqleqmkayaedveghvlpgcghwlpeecaapmnrlvidflsrgrhhh