PDB entry 3kd2

View 3kd2 on RCSB PDB site
Description: Crystal structure of the CFTR inhibitory factor Cif
Class: hydrolase
Keywords: ALPHA/BETA HYDROLASE, Hydrolase
Deposited on 2009-10-22, released 2010-01-26
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-10-12, with a file datestamp of 2011-10-07.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.167
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: CFTR inhibitory factor (Cif)
    Species: Pseudomonas aeruginosa UCBPP-PA14 [TaxId:208963]
    Gene: PA14_26090
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3kd2a_
  • Chain 'B':
    Compound: CFTR inhibitory factor (Cif)
    Species: Pseudomonas aeruginosa UCBPP-PA14 [TaxId:208963]
    Gene: PA14_26090
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3kd2b_
  • Chain 'C':
    Compound: CFTR inhibitory factor (Cif)
    Species: Pseudomonas aeruginosa UCBPP-PA14 [TaxId:208963]
    Gene: PA14_26090
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3kd2c_
  • Chain 'D':
    Compound: CFTR inhibitory factor (Cif)
    Species: Pseudomonas aeruginosa UCBPP-PA14 [TaxId:208963]
    Gene: PA14_26090
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3kd2d_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3kd2A (A:)
    aeefpvpngfesayrevdgvklhyvkggqgplvmlvhgfgqtwyewhqlmpelakrftvi
    apdlpglgqseppktgysgeqvavylhklarqfspdrpfdlvahdigiwntypmvvknqa
    diarlvymeapipdariyrfpaftaqgeslvwhfsffaaddrlaetliagkerfflehfi
    kshasntevfserlldlyarsyakphslnasfeyyralnesvrqnaelaktrlqmptmtl
    aggghggmgtfqleqmkayaedveghvlpgcghwlpeecaapmnrlvidflsrgrhhhhh
    h
    

    Sequence, based on observed residues (ATOM records): (download)
    >3kd2A (A:)
    aeefpvpngfesayrevdgvklhyvkggqgplvmlvhgfgqtwyewhqlmpelakrftvi
    apdlpglgqseppktgysgeqvavylhklarqfspdrpfdlvahdigiwntypmvvknqa
    diarlvymeapipdariyrfpaftaqgeslvwhfsffaaddrlaetliagkerfflehfi
    kshasntevfserlldlyarsyakphslnasfeyyralnesvrqnaelaktrlqmptmtl
    aggghggmgtfqleqmkayaedveghvlpgcghwlpeecaapmnrlvidflsr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3kd2B (B:)
    aeefpvpngfesayrevdgvklhyvkggqgplvmlvhgfgqtwyewhqlmpelakrftvi
    apdlpglgqseppktgysgeqvavylhklarqfspdrpfdlvahdigiwntypmvvknqa
    diarlvymeapipdariyrfpaftaqgeslvwhfsffaaddrlaetliagkerfflehfi
    kshasntevfserlldlyarsyakphslnasfeyyralnesvrqnaelaktrlqmptmtl
    aggghggmgtfqleqmkayaedveghvlpgcghwlpeecaapmnrlvidflsrgrhhhhh
    h
    

    Sequence, based on observed residues (ATOM records): (download)
    >3kd2B (B:)
    aeefpvpngfesayrevdgvklhyvkggqgplvmlvhgfgqtwyewhqlmpelakrftvi
    apdlpglgqseppktgysgeqvavylhklarqfspdrpfdlvahdigiwntypmvvknqa
    diarlvymeapipdariyrfpaftaqgeslvwhfsffaaddrlaetliagkerfflehfi
    kshasntevfserlldlyarsyakphslnasfeyyralnesvrqnaelaktrlqmptmtl
    aggghggmgtfqleqmkayaedveghvlpgcghwlpeecaapmnrlvidflsr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3kd2C (C:)
    aeefpvpngfesayrevdgvklhyvkggqgplvmlvhgfgqtwyewhqlmpelakrftvi
    apdlpglgqseppktgysgeqvavylhklarqfspdrpfdlvahdigiwntypmvvknqa
    diarlvymeapipdariyrfpaftaqgeslvwhfsffaaddrlaetliagkerfflehfi
    kshasntevfserlldlyarsyakphslnasfeyyralnesvrqnaelaktrlqmptmtl
    aggghggmgtfqleqmkayaedveghvlpgcghwlpeecaapmnrlvidflsrgrhhhhh
    h
    

    Sequence, based on observed residues (ATOM records): (download)
    >3kd2C (C:)
    aeefpvpngfesayrevdgvklhyvkggqgplvmlvhgfgqtwyewhqlmpelakrftvi
    apdlpglgqseppktgysgeqvavylhklarqfspdrpfdlvahdigiwntypmvvknqa
    diarlvymeapipdariyrfpaftaqgeslvwhfsffaaddrlaetliagkerfflehfi
    kshasntevfserlldlyarsyakphslnasfeyyralnesvrqnaelaktrlqmptmtl
    aggghggmgtfqleqmkayaedveghvlpgcghwlpeecaapmnrlvidflsr
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3kd2D (D:)
    aeefpvpngfesayrevdgvklhyvkggqgplvmlvhgfgqtwyewhqlmpelakrftvi
    apdlpglgqseppktgysgeqvavylhklarqfspdrpfdlvahdigiwntypmvvknqa
    diarlvymeapipdariyrfpaftaqgeslvwhfsffaaddrlaetliagkerfflehfi
    kshasntevfserlldlyarsyakphslnasfeyyralnesvrqnaelaktrlqmptmtl
    aggghggmgtfqleqmkayaedveghvlpgcghwlpeecaapmnrlvidflsrgrhhhhh
    h
    

    Sequence, based on observed residues (ATOM records): (download)
    >3kd2D (D:)
    aeefpvpngfesayrevdgvklhyvkggqgplvmlvhgfgqtwyewhqlmpelakrftvi
    apdlpglgqseppktgysgeqvavylhklarqfspdrpfdlvahdigiwntypmvvknqa
    diarlvymeapipdariyrfpaftaqgeslvwhfsffaaddrlaetliagkerfflehfi
    kshasntevfserlldlyarsyakphslnasfeyyralnesvrqnaelaktrlqmptmtl
    aggghggmgtfqleqmkayaedveghvlpgcghwlpeecaapmnrlvidflsr