PDB entry 3kcz

View 3kcz on RCSB PDB site
Description: Human poly(ADP-ribose) polymerase 2, catalytic fragment in complex with an inhibitor 3-aminobenzamide
Class: transferase
Keywords: transferase, enzyme-inhibitor complex, catalytic fragment, Structural Genomics, Structural Genomics Consortium, SGC, Glycosyltransferase, NAD, Nucleus, DNA-binding
Deposited on 2009-10-22, released 2009-11-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.19
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Poly [ADP-ribose] polymerase 2
    Species: Homo sapiens [TaxId:9606]
    Gene: ADPRT2, ADPRTL2, PARP2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9UGN5 (23-367)
      • expression tag (12-22)
      • see remark 999 (235)
    Domains in SCOPe 2.07: d3kcza1, d3kcza2, d3kcza3
  • Chain 'B':
    Compound: Poly [ADP-ribose] polymerase 2
    Species: Homo sapiens [TaxId:9606]
    Gene: ADPRT2, ADPRTL2, PARP2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9UGN5 (23-367)
      • expression tag (14-22)
      • see remark 999 (235)
    Domains in SCOPe 2.07: d3kczb1, d3kczb2, d3kczb3
  • Heterogens: 3AB, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3kczA (A:)
    mhhhhhhssgvdlgtenlyfqsmdlrvqeliklicnvqameemmmemkyntkkaplgklt
    vaqikagyqslkkiedciragqhgralmeacnefytriphdfglrtpplirtqkelseki
    qllealgdieiaiklvktelqspehpldqhyrnlhcalrpldhesyefkvisqylqstha
    pthsdytmtlldlfevekdgekeafredlhnrmllwhgsrmsnwvgilshglriahpeap
    itgymfgkgiyfadmssksanycfasrlkntgllllsevalgqcnelleanpkaegllqg
    khstkglgkmapssahfvtlngstvplgpasdtgilnpdgytlnyneyivynpnqvrmry
    llkvqfnf
    

    Sequence, based on observed residues (ATOM records): (download)
    >3kczA (A:)
    lgtenlyfqsmdlrvqeliklicnvqameemmmemkyntkkaplgkltvaqikagyqslk
    kiedciragqhgralmeacnefytriphdfglrtpplirtqkelsekiqllealgdieia
    iklvktelqspehpldqhyrnlhcalrpldhesyefkvisqylqsthapthsdytmtlld
    lfevekdgekeafredlhnrmllwhgsrmsnwvgilshglriahpeapitgymfgkgiyf
    admssksanycfasrlkntgllllsevalgqcnelleanpkaegllqgkhstkglgkmap
    ssahfvtlngstvplgpasdtgilgytlnyneyivynpnqvrmryllkvqfnf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3kczB (B:)
    mhhhhhhssgvdlgtenlyfqsmdlrvqeliklicnvqameemmmemkyntkkaplgklt
    vaqikagyqslkkiedciragqhgralmeacnefytriphdfglrtpplirtqkelseki
    qllealgdieiaiklvktelqspehpldqhyrnlhcalrpldhesyefkvisqylqstha
    pthsdytmtlldlfevekdgekeafredlhnrmllwhgsrmsnwvgilshglriahpeap
    itgymfgkgiyfadmssksanycfasrlkntgllllsevalgqcnelleanpkaegllqg
    khstkglgkmapssahfvtlngstvplgpasdtgilnpdgytlnyneyivynpnqvrmry
    llkvqfnf
    

    Sequence, based on observed residues (ATOM records): (download)
    >3kczB (B:)
    tenlyfqsmdlrvqeliklicnvqameemmmemkyntkkaplgkltvaqikagyqslkki
    edciragqhgralmeacnefytriphdfglrtpplirtqkelsekiqllealgdieiaik
    lvktelqspehpldqhyrnlhcalrpldhesyefkvisqylqsthapthsdytmtlldlf
    evekdgekeafredlhnrmllwhgsrmsnwvgilshglriahpeapitgymfgkgiyfad
    mssksanycfasrlkntgllllsevalgqcnelleanpkaegllqgkhstkglgkmapss
    ahfvtlngstvplgpasdtgytlnyneyivynpnqvrmryllkvqfnf