PDB entry 3kcx

View 3kcx on RCSB PDB site
Description: Factor inhibiting HIF-1 alpha in complex with Clioquinol
Class: Oxidoreductase
Keywords: hypoxia, HIF-1, FIH-1, inhibitor, Dioxygenase, Iron, Metal-binding, Nucleus, Oxidoreductase, Transcription, Transcription regulation
Deposited on 2009-10-22, released 2010-04-28
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-02-26, with a file datestamp of 2014-02-21.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.246
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hypoxia-inducible factor 1-alpha inhibitor
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3kcxa_
  • Heterogens: FE2, SO4, GOL, CQL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3kcxA (A:)
    epreeagalgpawdesqlrsysfptrpiprlsqsdpraeelieneepvvltdtnlvypal
    kwdleylqenigngdfsvysasthkflyydekkmanfqnfkprsnreemkfhefveklqd
    iqqrggeerlylqqtlndtvgrkivmdflgfnwnwinkqqgkrgwgqltsnllligmegn
    vtpahydeqqnffaqikgykrcilfppdqfeclypypvhhpcdrqsqvdfdnpdyerfpn
    fqnvvgyetvvgpgdvlyipmywwhhiesllnggititvnfwykgaptpkrieyplkahq
    kvaimrniekmlgealgnpqevgpllntmikgryn
    

    Sequence, based on observed residues (ATOM records): (download)
    >3kcxA (A:)
    epreeagalgpawdesqlrsysfptrpiprlsqsdpraeelieneepvvltdtnlvypal
    kwdleylqenigngdfsvysasthkflyydekkmanfqnfkprsnreemkfhefveklqd
    iqqrggeerlylqqtlndtvgrkivmdflgfnwnwinkqqgkrgwgqltsnllligmegn
    vtpahydeqqnffaqikgykrcilfppdqfeclypypvhhpcdrqsqvdfdnpdyerfpn
    fqnvvgyetvvgpgdvlyipmywwhhiesllnggititvnfwykgaptpeyplkahqkva
    imrniekmlgealgnpqevgpllntmikgryn