PDB entry 3kcn

View 3kcn on RCSB PDB site
Description: The crystal structure of adenylate cyclase from Rhodopirellula baltica
Class: lyase
Keywords: SGX, adenylate cyclase, PSI 2, Structural Genomics, Protein Structure Initiative, New York SGX Research Center for Structural Genomics, NYSGXRC
Deposited on 2009-10-21, released 2009-11-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-11-17, with a file datestamp of 2009-11-13.
Experiment type: XRAY
Resolution: 2.45 Å
R-factor: 0.22
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Adenylate cyclase homolog
    Species: Rhodopirellula baltica [TaxId:265606]
    Gene: cyaA, RB11090
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7UJS6 (3-End)
      • expression tag (2)
    Domains in SCOPe 2.07: d3kcna1, d3kcna2
  • Chain 'B':
    Compound: Adenylate cyclase homolog
    Species: Rhodopirellula baltica [TaxId:265606]
    Gene: cyaA, RB11090
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7UJS6 (3-End)
      • expression tag (2)
    Domains in SCOPe 2.07: d3kcnb1, d3kcnb2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3kcnA (A:)
    mslnerillvdddysllntlkrnlsfdfevttcesgpealacikksdpfsvimvdmrmpg
    megteviqkarlispnsvylmltgnqdlttameavnegqvfrflnkpcqmsdikaainag
    ikqydlvtskeellkktfagaiseghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3kcnA (A:)
    lnerillvdddysllntlkrnlsfdfevttcesgpealacikksdpfsvimvdmrmpgme
    gteviqkarlispnsvylmltgnqdlttameavnegqvfrflnkpcqmsdikaainagik
    qydlvtskeellkkt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3kcnB (B:)
    mslnerillvdddysllntlkrnlsfdfevttcesgpealacikksdpfsvimvdmrmpg
    megteviqkarlispnsvylmltgnqdlttameavnegqvfrflnkpcqmsdikaainag
    ikqydlvtskeellkktfagaiseghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3kcnB (B:)
    lnerillvdddysllntlkrnlsfdfevttcesgpealacikksdpfsvimvdmrmpgme
    gteviqkarlispnsvylmltgnqdlttameavnegqvfrflnkpcqmsdikaainagik
    qydlvtskeellkktfa