PDB entry 3kcc

View 3kcc on RCSB PDB site
Description: Crystal structure of D138L mutant of Catabolite Gene Activator Protein
Class: transcription
Keywords: helix-turn-helix, Activator, cAMP, cAMP-binding, DNA-binding, Nucleotide-binding, Transcription, Transcription regulation
Deposited on 2009-10-21, released 2009-11-17
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-08-10, with a file datestamp of 2011-08-05.
Experiment type: XRAY
Resolution: 1.66 Å
R-factor: 0.206
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Catabolite gene activator
    Species: Escherichia coli [TaxId:83333]
    Gene: crp
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ACJ8
      • engineered mutation (188)
    Domains in SCOPe 2.04: d3kcca1, d3kcca2
  • Chain 'B':
    Compound: Catabolite gene activator
    Species: Escherichia coli [TaxId:83333]
    Gene: crp
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ACJ8
      • engineered mutation (188)
    Domains in SCOPe 2.04: d3kccb1, d3kccb2
  • Heterogens: CMP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3kccA (A:)
    mhhhhhhssglvprgsgmketaaakferqhmdspdlgtddddkamadigsmvlgkpqtdp
    tlewflshchihkypskstlihqgekaetlyyivkgsvavlikdeegkemilsylnqgdf
    igelglfeegqersawvraktacevaeisykkfrqliqvnpdilmrlsaqmarrlqvtse
    kvgnlafllvtgriaqtllnlakqpdamthpdgmqikitrqeigqivgcsretvgrilkm
    ledqnlisahgktivvygtr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3kccA (A:)
    dptlewflshchihkypskstlihqgekaetlyyivkgsvavlikdeegkemilsylnqg
    dfigelglfeegqersawvraktacevaeisykkfrqliqvnpdilmrlsaqmarrlqvt
    sekvgnlafllvtgriaqtllnlakqpdamthpdgmqikitrqeigqivgcsretvgril
    kmledqnlisahgktivvy
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3kccB (B:)
    mhhhhhhssglvprgsgmketaaakferqhmdspdlgtddddkamadigsmvlgkpqtdp
    tlewflshchihkypskstlihqgekaetlyyivkgsvavlikdeegkemilsylnqgdf
    igelglfeegqersawvraktacevaeisykkfrqliqvnpdilmrlsaqmarrlqvtse
    kvgnlafllvtgriaqtllnlakqpdamthpdgmqikitrqeigqivgcsretvgrilkm
    ledqnlisahgktivvygtr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3kccB (B:)
    ptlewflshchihkypskstlihqgekaetlyyivkgsvavlikdeegkemilsylnqgd
    figelglfeegqersawvraktacevaeisykkfrqliqvnpdilmrlsaqmarrlqvts
    ekvgnlafllvtgriaqtllnlakqpdamthpdgmqikitrqeigqivgcsretvgrilk
    mledqnlisahgktivvy