PDB entry 3kbk

View 3kbk on RCSB PDB site
Description: Epi-isozizaene synthase complexed with Hg
Class: lyase
Keywords: terpenoid cyclase, Mg, metal-dependant, farnesyl diphosphate, Hg, Lyase, Magnesium, Metal-binding
Deposited on 2009-10-20, released 2010-02-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-03-09, with a file datestamp of 2010-03-05.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.171
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Epi-isozizaene synthase
    Species: Streptomyces coelicolor [TaxId:1902]
    Gene: cyc1, SCO5222, SC7E4.19
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3kbka_
  • Heterogens: HG, SO4, CL, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3kbkA (A:)
    mgsshhhhhhssglvprgshmvhafphgttatptaiavppslrlpvieaafprqlhpywp
    klqettrtwllekrlmpadkveeyadglcytdlmagyylgapdevlqaiadysawffvwd
    drhdrdivhgragawrrlrgllhtaldspgdhlhhedtlvagfadsvrrlyaflpatwna
    rfarhfhtvieaydrefhnrtrgivpgveeylelrrltfahwiwtdllepssgcelpdav
    rkhpayrraallsqefaawyndlcslpkeiagdevhnlgislithhsltleeaigevrrr
    veeciteflaverdalrfadeladgtvrgkelsgavranvgnmrnwfssvywfhhesgry
    mvdswddrstppyvnneaagek
    

    Sequence, based on observed residues (ATOM records): (download)
    >3kbkA (A:)
    vppslrlpvieaafprqlhpywpklqettrtwllekrlmpadkveeyadglcytdlmagy
    ylgapdevlqaiadysawffvwddrhdrdivhgragawrrlrgllhtaldspgdhlhhed
    tlvagfadsvrrlyaflpatwnarfarhfhtvieaydrefhnrtrgivpgeeylelrrlt
    fahwiwtdllepssgcelpdavrkhpayrraallsqefaawyndlcslpkeiatleeaig
    evrrrveeciteflaverdalrfadeladgtvrgkelsgavranvgnmrnwfssvywfhh
    esgry