PDB entry 3kbe

View 3kbe on RCSB PDB site
Description: Metal-free C. elegans Cu,Zn Superoxide Dismutase
Class: oxidoreductase
Keywords: cu-zn superoxide dismutase, antioxidant, oxidoreductase, nematode, Disulfide bond, Metal-binding
Deposited on 2009-10-20, released 2010-10-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-10-20, with a file datestamp of 2010-10-15.
Experiment type: XRAY
Resolution: 1.1 Å
R-factor: 0.155
AEROSPACI score: 0.9 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Superoxide dismutase [Cu-Zn]
    Species: Caenorhabditis elegans [TaxId:6239]
    Gene: C15F1.7, sod-1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3kbea_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3kbeA (A:)
    snravavlrgetvtgtiwitqksendqaviegeikgltpglhgfhvhqygdstngcisag
    phfnpfgkthggpkseirhvgdlgnveagadgvakikltdtlvtlygpntvvgrsmvvha
    gqddlgegvgdkaeeskktgnagaraacgvialaapq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3kbeA (A:)
    snravavlrgetvtgtiwitqksendqaviegeikgltpglhgfhvhqygdstngcisag
    phfnpfgkthggpkseirhvgdlgnveagadgvakikltdtlvtlygpntvvgrsmvvha
    gtgnagaraacgvialaapq