PDB entry 3kb9

View 3kb9 on RCSB PDB site
Description: Epi-isozizaene synthase: Complex with Mg, inorganic pyrophosphate and benzyl triethyl ammonium cation
Class: lyase
Keywords: terpenoid cyclase, alpha-helical fold, farnesyl diphosphate, metal-binding, Lyase, Magnesium
Deposited on 2009-10-20, released 2010-02-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-03-09, with a file datestamp of 2010-03-05.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.16
AEROSPACI score: 0.63 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Epi-isozizaene synthase
    Species: Streptomyces coelicolor [TaxId:1902]
    Gene: cyc1, SCO5222, SC7E4.19
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3kb9a_
  • Heterogens: MG, POP, BTM, SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3kb9A (A:)
    mgsshhhhhhssglvprgshmvhafphgttatptaiavppslrlpvieaafprqlhpywp
    klqettrtwllekrlmpadkveeyadglcytdlmagyylgapdevlqaiadysawffvwd
    drhdrdivhgragawrrlrgllhtaldspgdhlhhedtlvagfadsvrrlyaflpatwna
    rfarhfhtvieaydrefhnrtrgivpgveeylelrrltfahwiwtdllepssgcelpdav
    rkhpayrraallsqefaawyndlcslpkeiagdevhnlgislithhsltleeaigevrrr
    veeciteflaverdalrfadeladgtvrgkelsgavranvgnmrnwfssvywfhhesgry
    mvdswddrstppyvnneaagek
    

    Sequence, based on observed residues (ATOM records): (download)
    >3kb9A (A:)
    avppslrlpvieaafprqlhpywpklqettrtwllekrlmpadkveeyadglcytdlmag
    yylgapdevlqaiadysawffvwddrhdrdivhgragawrrlrgllhtaldspgdhlhhe
    dtlvagfadsvrrlyaflpatwnarfarhfhtvieaydrefhnrtrgivpgveeylelrr
    ltfahwiwtdllepssgcelpdavrkhpayrraallsqefaawyndlcslpkeiagdevh
    nlgislithhsltleeaigevrrrveeciteflaverdalrfadeladgtvrgkelsgav
    ranvgnmrnwfssvywfhhesgrymvdswddrstppyvnn