PDB entry 3kaa

View 3kaa on RCSB PDB site
Description: Structure of Tim-3 in complex with phosphatidylserine
Class: immune system
Keywords: Ig-like, protein-ligand complex, beta barrel, Receptor, IMMUNE SYSTEM
Deposited on 2009-10-19, released 2010-01-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-12-04, with a file datestamp of 2013-11-29.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.236
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hepatitis A virus cellular receptor 2
    Species: Mus musculus [TaxId:10090]
    Gene: Havcr2, Hepatitis A virus cellular receptor 2, Tim3, Timd3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3kaaa_
  • Chain 'B':
    Compound: Hepatitis A virus cellular receptor 2
    Species: Mus musculus [TaxId:10090]
    Gene: Havcr2, Hepatitis A virus cellular receptor 2, Tim3, Timd3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3kaab_
  • Heterogens: CA, PSF, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3kaaA (A:)
    msledgykvevgknaylpcsytlptsgtlvpmcwgkgfcpwsqctnellrtdernvtyqk
    ssryqlkgdlnkgdvsliiknvtlddhgtyccriqfpglmndkklelkldikaalvpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3kaaA (A:)
    gykvevgknaylpcsytlptsgtlvpmcwgkgfcpwsqctnellrtdernvtyqkssryq
    lkgdlnkgdvsliiknvtlddhgtyccriqfpglmndkklelkldik
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3kaaB (B:)
    msledgykvevgknaylpcsytlptsgtlvpmcwgkgfcpwsqctnellrtdernvtyqk
    ssryqlkgdlnkgdvsliiknvtlddhgtyccriqfpglmndkklelkldikaalvpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3kaaB (B:)
    dgykvevgknaylpcsytlptsgtlvpmcwgkgfcpwsqctnellrtdernvtyqkssry
    qlkgdlnkgdvsliiknvtlddhgtyccriqfpglmndkklelkldika