PDB entry 3ka9

View 3ka9 on RCSB PDB site
Description: Frog M-ferritin, EEH mutant, with cobalt
Class: oxidoreductase
Keywords: IRON STORAGE, DIIRON, Iron, Metal-binding, Oxidoreductase
Deposited on 2009-10-19, released 2010-10-06
The last revision prior to the SCOPe 2.05 freeze date was dated 2010-10-06, with a file datestamp of 2010-10-01.
Experiment type: XRAY
Resolution: 1.45 Å
R-factor: 0.131
AEROSPACI score: 0.73 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ferritin, middle subunit
    Species: Rana catesbeiana [TaxId:8400]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07798
      • engineered (137)
      • engineered (140)
    Domains in SCOPe 2.05: d3ka9a_
  • Heterogens: CO, MG, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3ka9A (A:)
    mvsqvrqnyhsdceaavnrmlnlelyasytyssmyaffdrddvalhnvaeffkehsheer
    ehaekfmkyqnkrggrvvlqdikkperdewgntleamqaalqlektvnqalldlhklatd
    kvdphlcdfleseyleeevkhikrigdfitnlkrlglpengmgeylfdkhsvkess
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ka9A (A:)
    vsqvrqnyhsdceaavnrmlnlelyasytyssmyaffdrddvalhnvaeffkehsheere
    haekfmkyqnkrggrvvlqdikkperdewgntleamqaalqlektvnqalldlhklatdk
    vdphlcdfleseyleeevkhikrigdfitnlkrlglpengmgeylfdkhsvke