PDB entry 3ka4

View 3ka4 on RCSB PDB site
Description: Frog M-ferritin with cobalt
Class: oxidoreductase
Keywords: IRON STORAGE, DIIRON, Iron, Metal-binding, Oxidoreductase
Deposited on 2009-10-18, released 2010-10-06
The last revision prior to the SCOPe 2.04 freeze date was dated 2010-10-27, with a file datestamp of 2010-10-22.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.149
AEROSPACI score: 0.74 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ferritin, middle subunit
    Species: Rana catesbeiana [TaxId:8400]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3ka4a_
  • Heterogens: CO, CL, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3ka4A (A:)
    mvsqvrqnyhsdceaavnrmlnlelyasytyssmyaffdrddvalhnvaeffkehsheer
    ehaekfmkyqnkrggrvvlqdikkperdewgntleamqaalqlektvnqalldlhklatd
    kvdphlcdfleseyleeqvkdikrigdfitnlkrlglpengmgeylfdkhsvkess
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ka4A (A:)
    vsqvrqnyhsdceaavnrmlnlelyasytyssmyaffdrddvalhnvaeffkehsheere
    haekfmkyqnkrggrvvlqdikkperdewgntleamqaalqlektvnqalldlhklatdk
    vdphlcdfleseyleeqvkdikrigdfitnlkrlglpengmgeylfdkhsvk