PDB entry 3ka0

View 3ka0 on RCSB PDB site
Description: MK2 complex with inhibitor 6-(5-(2-aminopyrimidin-4-ylamino)-2-hydroxyphenyl)-N-methylbenzo[b]thiophene-2-carboxamide
Class: transferase
Keywords: MAPKAP-K2, MK2, TNFalpha, diaminopyrimidine, ATP-binding, Kinase, Nucleotide-binding, Phosphoprotein, Serine/threonine-protein kinase, Transferase
Deposited on 2009-10-16, released 2010-01-12
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.232
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: MAP kinase-activated protein kinase 2
    Species: Homo sapiens [TaxId:9606]
    Gene: MAPKAPK2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3ka0a_
  • Heterogens: MK3, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3ka0A (A:)
    hvksglqikknaiiddykvtsqvlglgingkvlqifnkrtqekfalkmlqdcpkarreve
    lhwrasqcphivrivdvyenlyagrkcllivmecldggelfsriqdrgdqaftereasei
    mksigeaiqylhsiniahrdvkpenllytskrpnailkltdfgfakettshnsltepcyt
    pyyvapevlgpekydkscdmwslgvimyillcgyppfysnhglaispgmktrirmgqyef
    pnpewsevseevkmlirnllkteptqrmtitefmnhpwimqstkvpqtplhtsrvlkedk
    erwedvkeemtsalatmrvd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ka0A (A:)
    hvksglqikknaiiddykvtsqvlglgingkvlqifnkrtqekfalkmlqdcpkarreve
    lhwrasqcphivrivdvyenlyagrkcllivmecldggelfsriqdtereaseimksige
    aiqylhsiniahrdvkpenllytskrpnailkltdfgfaketkydkscdmwslgvimyil
    lcgyppfygmktrirmgqyefpnpewsevseevkmlirnllkteptqrmtitefmnhpwi
    mqstkvpqtplhtsrvlkedkerwedvkeemtsalatmr