PDB entry 3k9z

View 3k9z on RCSB PDB site
Description: Rational Design of a Structural and Functional Nitric Oxide Reductase
Class: oxygen transport
Keywords: Alpha HELIX, Heme, Iron, Metal-binding, Oxygen transport, Nitric Oxide Reduction
Deposited on 2009-10-16, released 2009-12-01
The last revision prior to the SCOPe 2.06 freeze date was dated 2010-01-12, with a file datestamp of 2010-01-08.
Experiment type: XRAY
Resolution: 1.72 Å
R-factor: 0.246
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Myoglobin
    Species: Physeter catodon [TaxId:9755]
    Gene: swMB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02185 (0-152)
      • engineered (28)
      • engineered (42)
      • engineered (67)
    Domains in SCOPe 2.06: d3k9za_
  • Heterogens: HEM, FE2, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3k9zA (A:)
    vlsegewqlvlhvwakveadvaghgqdihirlfkshpetlekhdrfkhlkteaemkased
    lkkhgvteltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrhp
    gdfgadaqgamnkalelfrkdiaakykelgyqg