PDB entry 3k95

View 3k95 on RCSB PDB site
Description: Crystal Structure of Transketolase Complexed with Thiamine Diphosphate from Bacillus anthracis
Class: transferase
Keywords: alpha-beta-alpha sandwich, CSGID, Transferase, Structural Genomics, structural genomics of infectious diseases, Center for Structural Genomics of Infectious Diseases
Deposited on 2009-10-15, released 2009-10-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-04-07, with a file datestamp of 2010-04-02.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.141
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: transketolase
    Species: Bacillus anthracis [TaxId:261594]
    Gene: BAA_3769, tkt-2, tkt2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3k95a1, d3k95a2, d3k95a3
  • Chain 'B':
    Compound: transketolase
    Species: Bacillus anthracis [TaxId:261594]
    Gene: BAA_3769, tkt-2, tkt2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3k95b1, d3k95b2, d3k95b3
  • Heterogens: MG, CL, FMT, GOL, SO4, ACY, PG5, PEG, TDP, BTB, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3k95A (A:)
    snamshsieqlsintirtlsidaiekansghpgmpmgaapmaytlwtqfmkhnpnnptwf
    nrdrfvlsaghgsmllysllhlsgydvtmddlknfrqwgsktpghpeyghtagvdattgp
    lgqgiatavgmamaerhlaakynrdaynivdhytyaicgdgdlmegvsaeasslaahlql
    grlvvlydsndisldgdlnrsfsesvedrykaygwqvirvedgndieaiakaieeakade
    krptlievrttigfgspnksgksashgsplgveetkltkeayawtaeqdfhvaeevyenf
    rktvqdvgetaqaewntmlgeyaqaypelanelqaamngllpegweqnlptyelgskaat
    rnssgavinaiaesvpsffggsadlagsnktymnnekdftrddysgkniwygvrefamga
    amngialhgglktyggtffvfsdylrpairlaalmqlpvtyvfthdsiavgedgpthepi
    eqlaalrampnvsvirpadgnesvaawrlalestnkptalvltrqdlptlegakddtyek
    vakgayvvsaskketadvillatgsevslaveaqkalavdgvdasvvsmpsmdrfeaqta
    eykesvlpkavtkrfaiemgatfgwhryvglegdvlgidtfgasapgekimeeygftven
    vvrkvkeml
    

    Sequence, based on observed residues (ATOM records): (download)
    >3k95A (A:)
    shsieqlsintirtlsidaiekansghpgmpmgaapmaytlwtqfmkhnpnnptwfnrdr
    fvlsaghgsmllysllhlsgydvtmddlknfrqwgsktpghpeyghtagvdattgplgqg
    iatavgmamaerhlaakynrdaynivdhytyaicgdgdlmegvsaeasslaahlqlgrlv
    vlydsndisldgdlnrsfsesvedrykaygwqvirvedgndieaiakaieeakadekrpt
    lievrttigfgspnksgksashgsplgveetkltkeayawtaeqdfhvaeevyenfrktv
    qdvgetaqaewntmlgeyaqaypelanelqaamngllpegweqnlptyelgskaatrnss
    gavinaiaesvpsffggsadlagsnktymnnekdftrddysgkniwygvrefamgaamng
    ialhgglktyggtffvfsdylrpairlaalmqlpvtyvfthdsiavgedgpthepieqla
    alrampnvsvirpadgnesvaawrlalestnkptalvltrqdlptlegakddtyekvakg
    ayvvsaskketadvillatgsevslaveaqkalavdgvdasvvsmpsmdrfeaqtaeyke
    svlpkavtkrfaiemgatfgwhryvglegdvlgidtfgasapgekimeeygftvenvvrk
    vkeml
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3k95B (B:)
    snamshsieqlsintirtlsidaiekansghpgmpmgaapmaytlwtqfmkhnpnnptwf
    nrdrfvlsaghgsmllysllhlsgydvtmddlknfrqwgsktpghpeyghtagvdattgp
    lgqgiatavgmamaerhlaakynrdaynivdhytyaicgdgdlmegvsaeasslaahlql
    grlvvlydsndisldgdlnrsfsesvedrykaygwqvirvedgndieaiakaieeakade
    krptlievrttigfgspnksgksashgsplgveetkltkeayawtaeqdfhvaeevyenf
    rktvqdvgetaqaewntmlgeyaqaypelanelqaamngllpegweqnlptyelgskaat
    rnssgavinaiaesvpsffggsadlagsnktymnnekdftrddysgkniwygvrefamga
    amngialhgglktyggtffvfsdylrpairlaalmqlpvtyvfthdsiavgedgpthepi
    eqlaalrampnvsvirpadgnesvaawrlalestnkptalvltrqdlptlegakddtyek
    vakgayvvsaskketadvillatgsevslaveaqkalavdgvdasvvsmpsmdrfeaqta
    eykesvlpkavtkrfaiemgatfgwhryvglegdvlgidtfgasapgekimeeygftven
    vvrkvkeml
    

    Sequence, based on observed residues (ATOM records): (download)
    >3k95B (B:)
    hsieqlsintirtlsidaiekansghpgmpmgaapmaytlwtqfmkhnpnnptwfnrdrf
    vlsaghgsmllysllhlsgydvtmddlknfrqwgsktpghpeyghtagvdattgplgqgi
    atavgmamaerhlaakynrdaynivdhytyaicgdgdlmegvsaeasslaahlqlgrlvv
    lydsndisldgdlnrsfsesvedrykaygwqvirvedgndieaiakaieeakadekrptl
    ievrttigfgspnksgksashgsplgveetkltkeayawtaeqdfhvaeevyenfrktvq
    dvgetaqaewntmlgeyaqaypelanelqaamngllpegweqnlptyelgskaatrnssg
    avinaiaesvpsffggsadlagsnktymnnekdftrddysgkniwygvrefamgaamngi
    alhgglktyggtffvfsdylrpairlaalmqlpvtyvfthdsiavgedgpthepieqlaa
    lrampnvsvirpadgnesvaawrlalestnkptalvltrqdlptlegakddtyekvakga
    yvvsaskketadvillatgsevslaveaqkalavdgvdasvvsmpsmdrfeaqtaeykes
    vlpkavtkrfaiemgatfgwhryvglegdvlgidtfgasapgekimeeygftvenvvrkv
    keml