PDB entry 3k91

View 3k91 on RCSB PDB site
Description: Polysulfane Bridge in Cu-Zn Superoxide Dismutase
Class: Oxidoreductase
Keywords: human cu-zn superoxide dismutase, amyotrophic lateral sclerosis, antioxidant, oxidoreductase, sulfur, polysulfane, Disease mutation, Disulfide bond, Metal-binding, Neurodegeneration, Phosphoprotein
Deposited on 2009-10-15, released 2010-01-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-01-12, with a file datestamp of 2011-01-07.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.189
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Superoxide dismutase [Cu-Zn]
    Species: Homo sapiens [TaxId:9606]
    Gene: SOD1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00441 (0-152)
      • engineered (45)
      • engineered (47)
    Domains in SCOPe 2.07: d3k91a_
  • Chain 'B':
    Compound: Superoxide dismutase [Cu-Zn]
    Species: Homo sapiens [TaxId:9606]
    Gene: SOD1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00441 (0-152)
      • engineered (45)
      • engineered (47)
    Domains in SCOPe 2.07: d3k91b_
  • Heterogens: PS5, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3k91A (A:)
    atkavcvlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfrvqefgdntagctsa
    gphfnplsrkhggpkdeerhvgdlgnvtadkdgvadvsiedsvislsgdhciigrtlvvh
    ekaddlgkggneestktgnagsrlacgvigiaq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3k91A (A:)
    atkavcvlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfrvqefgdntagctsa
    gphfnplsrkhggpkdrhvgdlgnvtadkdgvadvsiedsvislsgdhciigrtlvvhek
    addlgkgestktgnagsrlacgvigiaq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3k91B (B:)
    atkavcvlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfrvqefgdntagctsa
    gphfnplsrkhggpkdeerhvgdlgnvtadkdgvadvsiedsvislsgdhciigrtlvvh
    ekaddlgkggneestktgnagsrlacgvigiaq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3k91B (B:)
    atkavcvlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfrvqefgdntagctsa
    gphfnplrhvgdlgnvtadkdgvadvsiedsvislsgdhciigrtlvvhekadnagsrla
    cgvigiaq