PDB entry 3k6k

View 3k6k on RCSB PDB site
Description: Crystal structure at 2.2 angstrom of HSL-homolog EstE7 from a metagenome library
Class: hydrolase
Keywords: alpha/beta hydrolase fold, HYDROLASE
Deposited on 2009-10-09, released 2009-10-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Esterase/lipase
    Species: Uncultured bacterium [TaxId:77133]
    Gene: estE7
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3k6ka_
  • Chain 'B':
    Compound: Esterase/lipase
    Species: Uncultured bacterium [TaxId:77133]
    Gene: estE7
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3k6kb_
  • Chain 'C':
    Compound: Esterase/lipase
    Species: Uncultured bacterium [TaxId:77133]
    Gene: estE7
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3k6kc_
  • Chain 'D':
    Compound: Esterase/lipase
    Species: Uncultured bacterium [TaxId:77133]
    Gene: estE7
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3k6kd_
  • Heterogens: SO4, BME, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3k6kA (A:)
    mgamdqeigtvtdtkmdprdflqllkinaekaeknlpldqkragmealcerfpraegvel
    tltdlggvpcirqatdgagaahilyfhgggyisgspsthlvlttqlakqssatlwsldyr
    lapenpfpaavddcvaayrallktagsadriiiagdsaggglttasmlkakedglpmpag
    lvmlspfvdltlsrwsnsnladrdflaepdtlgemselyvggedrknplispvyadlsgl
    pemlihvgseeallsdsttlaeragaagvsvelkiwpdmphvfqmygkfvnaadisikei
    chwisarisklaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3k6kA (A:)
    dtkmdprdflqllkinaekaeknlpldqkragmealcerfpraegveltltdlggvpcir
    qatdgagaahilyfhgggyisgspsthlvlttqlakqssatlwsldyrlapenpfpaavd
    dcvaayrallktagsadriiiagdsaggglttasmlkakedglpmpaglvmlspfvdltl
    srwsnsnladrdflaepdtlgemselyvggedrknplispvyadlsglpemlihvgseea
    llsdsttlaeragaagvsvelkiwpdmphvfqmygkfvnaadisikeichwisaris
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3k6kB (B:)
    mgamdqeigtvtdtkmdprdflqllkinaekaeknlpldqkragmealcerfpraegvel
    tltdlggvpcirqatdgagaahilyfhgggyisgspsthlvlttqlakqssatlwsldyr
    lapenpfpaavddcvaayrallktagsadriiiagdsaggglttasmlkakedglpmpag
    lvmlspfvdltlsrwsnsnladrdflaepdtlgemselyvggedrknplispvyadlsgl
    pemlihvgseeallsdsttlaeragaagvsvelkiwpdmphvfqmygkfvnaadisikei
    chwisarisklaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3k6kB (B:)
    dtkmdprdflqllkinaekaeknlpldqkragmealcerfpraegveltltdlggvpcir
    qatdgagaahilyfhgggyisgspsthlvlttqlakqssatlwsldyrlapenpfpaavd
    dcvaayrallktagsadriiiagdsaggglttasmlkakedglpmpaglvmlspfvdltl
    srwsnsnladrdflaepdtlgemselyvggedrknplispvyadlsglpemlihvgseea
    llsdsttlaeragaagvsvelkiwpdmphvfqmygkfvnaadisikeichwisaris
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3k6kC (C:)
    mgamdqeigtvtdtkmdprdflqllkinaekaeknlpldqkragmealcerfpraegvel
    tltdlggvpcirqatdgagaahilyfhgggyisgspsthlvlttqlakqssatlwsldyr
    lapenpfpaavddcvaayrallktagsadriiiagdsaggglttasmlkakedglpmpag
    lvmlspfvdltlsrwsnsnladrdflaepdtlgemselyvggedrknplispvyadlsgl
    pemlihvgseeallsdsttlaeragaagvsvelkiwpdmphvfqmygkfvnaadisikei
    chwisarisklaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3k6kC (C:)
    tkmdprdflqllkinaekadqkragmealcerfpraegveltltdlggvpcirqatdgag
    aahilyfhgggyisgspsthlvlttqlakqssatlwsldyrlapenpfpaavddcvaayr
    allktagsadriiiagdsaggglttasmlkakedglpmpaglvmlspfvdltlsrwsnsn
    ladrdflaepdtlgemselyvggedrknplispvyadlsglpemlihvgseeallsdstt
    laeragaagvsvelkiwpdmphvfqmygkfvnaadisikeichwisaris
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3k6kD (D:)
    mgamdqeigtvtdtkmdprdflqllkinaekaeknlpldqkragmealcerfpraegvel
    tltdlggvpcirqatdgagaahilyfhgggyisgspsthlvlttqlakqssatlwsldyr
    lapenpfpaavddcvaayrallktagsadriiiagdsaggglttasmlkakedglpmpag
    lvmlspfvdltlsrwsnsnladrdflaepdtlgemselyvggedrknplispvyadlsgl
    pemlihvgseeallsdsttlaeragaagvsvelkiwpdmphvfqmygkfvnaadisikei
    chwisarisklaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3k6kD (D:)
    mdprdflqllkinaekaeknlpldqkragmealcerfpraegveltltdlggvpcirqat
    dgagaahilyfhgggyisgspsthlvlttqlakqssatlwsldyrlapenpfpaavddcv
    aayrallktagsadriiiagdsaggglttasmlkakedglpmpaglvmlspfvdltlsrw
    snsnladrdflaepdtlgemselyvggedrknplispvyadlsglpemlihvgseealls
    dsttlaeragaagvsvelkiwpdmphvfqmygkfvnaadisikeichwisari