PDB entry 3k69

View 3k69 on RCSB PDB site
Description: crystal structure of a putative transcriptional regulator (lp_0360) from lactobacillus plantarum at 1.95 a resolution
Class: transcription
Keywords: putative transcriptional regulator, structural genomics, joint center for structural genomics, jcsg, protein structure initiative, psi-2, transcription
Deposited on 2009-10-08, released 2009-11-03
The last revision prior to the SCOPe 2.02 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.174
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: putative transcription regulator
    Species: Lactobacillus plantarum [TaxId:1590]
    Gene: lp_0360
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d3k69a_
  • Heterogens: DMS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3k69A (A:)
    gmggsnmkldfsvavhsilyldahrdskvasrelaqslhlnpvmirnilsvlhkhgyltg
    tvgknggyqldlaladmnlgdlydltipptisyarfitgpsktdeqadqspiaanisetl
    tdlftvadrqyrayyhqftmadlqadlnhhgtflqheqdses
    

    Sequence, based on observed residues (ATOM records): (download)
    >3k69A (A:)
    mkldfsvavhsilyldahrdskvasrelaqslhlnpvmirnilsvlhkhgyltgtvgkng
    gyqldlaladmnlgdlydltipptisyarfitgpskadqspiaanisetltdlftvadrq
    yrayyhqftmadlqadlnhhgtflqheqdse