PDB entry 3k51

View 3k51 on RCSB PDB site
Description: Crystal Structure of DcR3-TL1A complex
Class: immune system
Keywords: DcR3, TL1A, TNF, TNFR, DECOY RECEPTOR, IMMUNITY, Cytokine, Disulfide bond, Glycoprotein, Membrane, Secreted, Signal-anchor, Transmembrane, Apoptosis, Receptor, IMMUNE SYSTEM
Deposited on 2009-10-06, released 2010-10-13
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-02-23, with a file datestamp of 2011-02-18.
Experiment type: XRAY
Resolution: 2.45 Å
R-factor: 0.224
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tumor necrosis factor ligand superfamily member 15, secreted form
    Species: Homo sapiens [TaxId:9606]
    Gene: TL1, TNFSF15, VEGI
    Database cross-references and differences (RAF-indexed):
    • Uniprot O95150 (Start-183)
      • engineered (134)
    Domains in SCOPe 2.06: d3k51a_
  • Chain 'B':
    Compound: Decoy receptor 3
    Species: Homo sapiens [TaxId:9606]
    Gene: DCR3, TNFRSF6B, TR6, UNQ186/PRO212
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3k51A (A:)
    gshmlkgqefapshqqvyaplradgdkprahltvvrqtptqhfknqfpalhwehelglaf
    tknrmnytnkfllipesgdyfiysqvtfrgmtsesseirqagrpnkpdsitvvitkvtds
    ypeptqllmgtksvsevgsnwfqpiylgamfslqegdklmvnvsdislvdytkedktffg
    afll
    

    Sequence, based on observed residues (ATOM records): (download)
    >3k51A (A:)
    gdkprahltvvrqtptqhfknqfpalhwehelglaftknrmnytnkfllipesgdyfiys
    qvtfrgmpdsitvvitkvtdsypeptqllmgtksvsgsnwfqpiylgamfslqegdklmv
    nvsdislvdytkedktffgafll
    

  • Chain 'B':
    No sequence available.