PDB entry 3k49

View 3k49 on RCSB PDB site
Description: Puf3 RNA binding domain bound to Cox17 RNA 3' UTR recognition sequence site B
Class: RNA Binding protein / RNA
Keywords: PUF3, PUMILIO, RNA BINDING, mitochondrial mRNA,, Membrane, Mitochondrion, Mitochondrion outer membrane, Phosphoprotein, RNA-binding, RNA Binding protein - RNA COMPLEX
Deposited on 2009-10-05, released 2009-10-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-02-09, with a file datestamp of 2011-02-04.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.23
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: mRNA-binding protein PUF3
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: L1325, PUF3, YLL013C
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3k49a_
  • Chain 'B':
    Compound: RNA (5'-r(*cp*cp*up*gp*up*ap*ap*ap*up*a)-3')
    Species: synthetic, synthetic
  • Chain 'C':
    Compound: mRNA-binding protein PUF3
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: L1325, PUF3, YLL013C
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3k49c_
  • Chain 'D':
    Compound: RNA (5'-r(*cp*cp*up*gp*up*ap*ap*ap*up*a)-3')
    Species: synthetic, synthetic
  • Chain 'E':
    Compound: mRNA-binding protein PUF3
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: L1325, PUF3, YLL013C
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3k49e_
  • Chain 'F':
    Compound: RNA (5'-r(*cp*cp*up*gp*up*ap*ap*ap*up*a)-3')
    Species: synthetic, synthetic
  • Heterogens: CIT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3k49A (A:)
    tyhrsplleqlrnsssdknsnsnmslkdifghslefckdqhgsrfiqrelatspasekev
    ifneirddaielsndvfgnyviqkffefgskiqkntlvdqfkgnmkqlslqmyacrviqk
    aleyidsnqrielvlelsdsvlqmikdqngnhviqkaietipieklpfilssltghiyhl
    sthsygcrviqrllefgssedqesilnelkdfipyliqdqygnyviqyvlqqdqftnkem
    vdikqeiietvannvveyskhkfasnvveksilygsknqkdliiskilprdknhalnled
    dspmilmikdqfanyviqklvnvsegegkkliviairayldklnksnslgnrhlasvekl
    aalvenaev
    

    Sequence, based on observed residues (ATOM records): (download)
    >3k49A (A:)
    splleqlrnsssnmslkdifghslefckdqhgsrfiqrelatspasekevifneirddai
    elsndvfgnyviqkffefgskiqkntlvdqfkgnmkqlslqmyacrviqkaleyidsnqr
    ielvlelsdsvlqmikdqngnhviqkaietipieklpfilssltghiyhlsthsygcrvi
    qrllefgssedqesilnelkdfipyliqdqygnyviqyvlqqdqftnkemvdikqeiiet
    vannvveyskhkfasnvveksilygsknqkdliiskilprdknhalnleddspmilmikd
    qfanyviqklvnvsegegkkliviairayldklnksngnrhlasveklaalve
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3k49C (C:)
    tyhrsplleqlrnsssdknsnsnmslkdifghslefckdqhgsrfiqrelatspasekev
    ifneirddaielsndvfgnyviqkffefgskiqkntlvdqfkgnmkqlslqmyacrviqk
    aleyidsnqrielvlelsdsvlqmikdqngnhviqkaietipieklpfilssltghiyhl
    sthsygcrviqrllefgssedqesilnelkdfipyliqdqygnyviqyvlqqdqftnkem
    vdikqeiietvannvveyskhkfasnvveksilygsknqkdliiskilprdknhalnled
    dspmilmikdqfanyviqklvnvsegegkkliviairayldklnksnslgnrhlasvekl
    aalvenaev
    

    Sequence, based on observed residues (ATOM records): (download)
    >3k49C (C:)
    splleqlrnsssnmslkdifghslefckdqhgsrfiqrelatspasekevifneirddai
    elsndvfgnyviqkffefgskiqkntlvdqfkgnmkqlslqmyacrviqkaleyidsnqr
    ielvlelsdsvlqmikdqngnhviqkaietipieklpfilssltghiyhlsthsygcrvi
    qrllefgssedqesilnelkdfipyliqdqygnyviqyvlqqdqftnkemvdikqeiiet
    vannvveyskhkfasnvveksilygsknqkdliiskilprdknhalnleddspmilmikd
    qfanyviqklvnvsegegkkliviairayldklnksngnrhlasveklaalve
    

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3k49E (E:)
    tyhrsplleqlrnsssdknsnsnmslkdifghslefckdqhgsrfiqrelatspasekev
    ifneirddaielsndvfgnyviqkffefgskiqkntlvdqfkgnmkqlslqmyacrviqk
    aleyidsnqrielvlelsdsvlqmikdqngnhviqkaietipieklpfilssltghiyhl
    sthsygcrviqrllefgssedqesilnelkdfipyliqdqygnyviqyvlqqdqftnkem
    vdikqeiietvannvveyskhkfasnvveksilygsknqkdliiskilprdknhalnled
    dspmilmikdqfanyviqklvnvsegegkkliviairayldklnksnslgnrhlasvekl
    aalvenaev
    

    Sequence, based on observed residues (ATOM records): (download)
    >3k49E (E:)
    splleqlrnsssnmslkdifghslefckdqhgsrfiqrelatspasekevifneirddai
    elsndvfgnyviqkffefgskiqkntlvdqfkgnmkqlslqmyacrviqkaleyidsnqr
    ielvlelsdsvlqmikdqngnhviqkaietipieklpfilssltghiyhlsthsygcrvi
    qrllefgssedqesilnelkdfipyliqdqygnyviqyvlqqdqftnkemvdikqeiiet
    vannvveyskhkfasnvveksilygsknqkdliiskilprdknhalnleddspmilmikd
    qfanyviqklvnvsegegkkliviairayldklnksngnrhlasveklaalve
    

  • Chain 'F':
    No sequence available.