PDB entry 3k46

View 3k46 on RCSB PDB site
Description: Crystal structure of full-length E. coli beta-glucuronidase
Class: hydrolase
Keywords: alpha/beta barrel, sugar-binding domain, beta-sandwich domain, glycosyl hydrolase, Glycosidase, Hydrolase
Deposited on 2009-10-05, released 2010-11-17
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.217
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: beta-glucuronidase
    Species: Escherichia coli [TaxId:83333]
    Gene: b1617, gurA, gusA, JW1609, uidA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05804 (2-End)
      • expression tag (0-1)
    Domains in SCOPe 2.06: d3k46a1, d3k46a2, d3k46a3, d3k46a4
  • Chain 'B':
    Compound: beta-glucuronidase
    Species: Escherichia coli [TaxId:83333]
    Gene: b1617, gurA, gusA, JW1609, uidA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05804 (2-End)
      • expression tag (0-1)
    Domains in SCOPe 2.06: d3k46b1, d3k46b2, d3k46b3, d3k46b4
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3k46A (A:)
    shmlrpvetptreikkldglwafsldrencgidqrwwesalqesraiavpgsfndqfada
    dirnyagnvwyqrevfipkgwagqrivlrfdavthygkvwvnnqevmehqggytpfeadv
    tpyviagksvritvcvnnelnwqtippgmvitdengkkkqsyfhdffnyagihrsvmlyt
    tpntwvdditvvthvaqdcnhasvdwqvvangdvsvelrdadqqvvatgqgtsgtlqvvn
    phlwqpgegylyelcvtaksqtecdiyplrvgirsvavkgeqflinhkpfyftgfgrhed
    adlrgkgfdnvlmvhdhalmdwigansyrtshypyaeemldwadehgivvidetaavgfn
    lslgigfeagnkpkelyseeavngetqqahlqaikeliardknhpsvvmwsianepdtrp
    qgareyfaplaeatrkldptrpitcvnvmfcdahtdtisdlfdvlclnryygwyvqsgdl
    etaekvlekellawqeklhqpiiiteygvdtlaglhsmytdmwseeyqcawldmyhrvfd
    rvsavvgeqvwnfadfatsqgilrvggnkkgiftrdrkpksaafllqkrwtgmnfgekpq
    qggkq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3k46A (A:)
    shmlrpvetptreikkldglwafsldrencgidqrwwesalqesraiavpgsfndqfada
    dirnyagnvwyqrevfipkgwagqrivlrfdavthygkvwvnnqevmehqggytpfeadv
    tpyviagksvritvcvnnelnwqtippgmvitdengkkkqsyfhdffnyagihrsvmlyt
    tpntwvdditvvthvaqdcnhasvdwqvvangdvsvelrdadqqvvatgqgtsgtlqvvn
    phlwqpgegylyelcvtaksqtecdiyplrvgirsvavkgeqflinhkpfyftgfgrhed
    adlrgkgfdnvlmvhdhalmdwigansyrtshypyaeemldwadehgivvidetaavgfn
    lslgnkpkelyseeavngetqqahlqaikeliardknhpsvvmwsianepdtrpqgarey
    faplaeatrkldptrpitcvnvmfcdahtdtisdlfdvlclnryygwyvqsgdletaekv
    lekellawqeklhqpiiiteygvdtlaglhsmytdmwseeyqcawldmyhrvfdrvsavv
    geqvwnfadfatsqgilrvggnkkgiftrdrkpksaafllqkrwtgmnfgekpqqgg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3k46B (B:)
    shmlrpvetptreikkldglwafsldrencgidqrwwesalqesraiavpgsfndqfada
    dirnyagnvwyqrevfipkgwagqrivlrfdavthygkvwvnnqevmehqggytpfeadv
    tpyviagksvritvcvnnelnwqtippgmvitdengkkkqsyfhdffnyagihrsvmlyt
    tpntwvdditvvthvaqdcnhasvdwqvvangdvsvelrdadqqvvatgqgtsgtlqvvn
    phlwqpgegylyelcvtaksqtecdiyplrvgirsvavkgeqflinhkpfyftgfgrhed
    adlrgkgfdnvlmvhdhalmdwigansyrtshypyaeemldwadehgivvidetaavgfn
    lslgigfeagnkpkelyseeavngetqqahlqaikeliardknhpsvvmwsianepdtrp
    qgareyfaplaeatrkldptrpitcvnvmfcdahtdtisdlfdvlclnryygwyvqsgdl
    etaekvlekellawqeklhqpiiiteygvdtlaglhsmytdmwseeyqcawldmyhrvfd
    rvsavvgeqvwnfadfatsqgilrvggnkkgiftrdrkpksaafllqkrwtgmnfgekpq
    qggkq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3k46B (B:)
    shmlrpvetptreikkldglwafsldrencgidqrwwesalqesraiavpgsfndqfada
    dirnyagnvwyqrevfipkgwagqrivlrfdavthygkvwvnnqevmehqggytpfeadv
    tpyviagksvritvcvnnelnwqtippgmvitdengkkkqsyfhdffnyagihrsvmlyt
    tpntwvdditvvthvaqdcnhasvdwqvvangdvsvelrdadqqvvatgqgtsgtlqvvn
    phlwqpgegylyelcvtaksqtecdiyplrvgirsvavkgeqflinhkpfyftgfgrhed
    adlrgkgfdnvlmvhdhalmdwigansyrtshypyaeemldwadehgivvidetaavgfn
    lslgnkpkelyseeavngetqqahlqaikeliardknhpsvvmwsianepdtrpqgarey
    faplaeatrkldptrpitcvnvmfcdahtdtisdlfdvlclnryygwyvqsgdletaekv
    lekellawqeklhqpiiiteygvdtlaglhsmytdmwseeyqcawldmyhrvfdrvsavv
    geqvwnfadfatsqgilrvggnkkgiftrdrkpksaafllqkrwtgmnfgekpqqg