PDB entry 3k3q
View 3k3q on RCSB PDB site
Description: Crystal Structure of a Llama Antibody complexed with the C. Botulinum Neurotoxin Serotype A Catalytic Domain
Class: immune system
Keywords: llama, VHH, antibody, botulinum, neurotoxin, BoNT, Cell junction, Cell membrane, Cytoplasm, Disulfide bond, Hydrolase, Membrane, Metal-binding, Metalloprotease, Pharmaceutical, Protease, Secreted, Synapse, Toxin, Transmembrane, Zinc, IMMUNE SYSTEM
Deposited on
2009-10-04, released
2010-02-23
The last revision prior to the SCOPe 2.05 freeze date was dated
2010-04-07, with a file datestamp of
2010-04-02.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.218
AEROSPACI score: 0.28
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: llama Aa1 VHH domain
Species: Lama glama [TaxId:9844]
Gene: llama VHH immunoglobulin
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.05: d3k3qa_ - Chain 'B':
Compound: Botulinum neurotoxin type A
Species: Clostridium botulinum A str. Hall [TaxId:441771]
Gene: botA, CBO0806, CLC_0862, neurotoxin catalytic domain
Database cross-references and differences (RAF-indexed):
- Uniprot A5HZZ9 (4-251)
- expression tag (3)
- see remark 999 (28)
- Chain 'C':
Compound: Botulinum neurotoxin type A
Species: Clostridium botulinum A str. Hall [TaxId:441771]
Gene: botA, CBO0806, CLC_0862, neurotoxin catalytic domain
Database cross-references and differences (RAF-indexed):
- Heterogens: ZN, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence, based on SEQRES records: (download)
>3k3qA (A:)
mdiavqlvdsgggtlqagkslrlscaisglafdggamgsehrltagamgwfrqapgkdre
fvaaisprtdetyyaeslegrfsvsrdaaatmvflqadnvrlddtasyycaadedvtprv
mgviphadhwgqgtlvtvssaaalehhhhhh
Sequence, based on observed residues (ATOM records): (download)
>3k3qA (A:)
avqlvdsgggtlqagkslrlscaisglafdggamgsehrltagamgwfrqapgkdrefva
aisprtdetyyaeslegrfsvsrdaaatmvflqadnvrlddtasyycaadedvtprvmgv
iphadhwgqgtlvtvss
- Chain 'B':
No sequence available.
- Chain 'C':
No sequence available.