PDB entry 3k3p

View 3k3p on RCSB PDB site
Description: Crystal Structure of the Apo Form of D-Alanine:D-Alanine Ligase (DDl) from Streptococcus mutans
Class: ligase
Keywords: D-alanyl-alanine synthetase, ATP-binding, Cell shape, Cell wall biogenesis/degradation, Ligase, Magnesium, Manganese, Metal-binding, Nucleotide-binding, Peptidoglycan synthesis
Deposited on 2009-10-03, released 2010-09-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-09-15, with a file datestamp of 2010-09-10.
Experiment type: XRAY
Resolution: 2.23 Å
R-factor: 0.199
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: d-alanine--d-alanine ligase
    Species: Streptococcus mutans [TaxId:1309]
    Gene: ddl
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3k3pa1, d3k3pa2
  • Chain 'B':
    Compound: d-alanine--d-alanine ligase
    Species: Streptococcus mutans [TaxId:1309]
    Gene: ddl
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3k3pb1, d3k3pb2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3k3pA (A:)
    mgsshhhhhhssglvprgshmasmtggqqmgrgsmsketlvllyggrsaerdvsvlsaes
    vmrainydnflvktyfitqagdfiktqefdsqpsetdklmtndtiiasqkikpsdiyeee
    avvfpvlhgpmgedgsiqgflevlkmpyvgtnilsssvamdkittnqvlesattipqvay
    valiegeplesklaeveekliypvfvkpanmgssvgiskaenrtdlkqaialalkydsrv
    lieqgvdareievgilgntdvkttlpgeivkdvafydyeakyidnkitmaipaeidpviv
    ekmrdyaatafrtlgccglsrcdffltedgkvylnelntmpgftqwsmypllwenmglsy
    svlieelvslakemfdkreshlv
    

    Sequence, based on observed residues (ATOM records): (download)
    >3k3pA (A:)
    ketlvllyggrsaerdvsvlsaesvmrainydnflvktyfitqagdfiktqefdsqpsdk
    lmtndtiiasqkikpsdiyeeeavvfpvlhgpmgedgsiqgflevlkmpyvgtnilsssv
    amdkittnqvlesattipqvayvaliegeplesklaeveekliypvfvkpaniskaenrt
    dlkqaialalkydsrvlieqgvdareievgilgntdvkttlpgeivtmaipaeidpvive
    kmrdyaatafrtlgccglsrcdffltedgkvylnelntmpgftsmypllwenmglsysvl
    ieelvslakemfdkres
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3k3pB (B:)
    mgsshhhhhhssglvprgshmasmtggqqmgrgsmsketlvllyggrsaerdvsvlsaes
    vmrainydnflvktyfitqagdfiktqefdsqpsetdklmtndtiiasqkikpsdiyeee
    avvfpvlhgpmgedgsiqgflevlkmpyvgtnilsssvamdkittnqvlesattipqvay
    valiegeplesklaeveekliypvfvkpanmgssvgiskaenrtdlkqaialalkydsrv
    lieqgvdareievgilgntdvkttlpgeivkdvafydyeakyidnkitmaipaeidpviv
    ekmrdyaatafrtlgccglsrcdffltedgkvylnelntmpgftqwsmypllwenmglsy
    svlieelvslakemfdkreshlv
    

    Sequence, based on observed residues (ATOM records): (download)
    >3k3pB (B:)
    ketlvllyggrsaerdvsvlsaesvmrainydnflvktyfitqagdfiktqefdsqpsdk
    lmtndtiiasqkikpsdiyeeeavvfpvlhgpmgedgsiqgflevlkmpyvgtnilsssv
    amdkittnqvlesattipqvayvaliegeplesklaeveekliypvfvkpangiskaenr
    tdlkqaialalkydsrvlieqgvdareievgilgntdvkttlpgeivtmaipaeidpviv
    ekmrdyaatafrtlgccglsrcdffltedgkvylnelntmpgftsmypllwenmglsysv
    lieelvslakemfdkres