PDB entry 3k2z

View 3k2z on RCSB PDB site
Description: Crystal structure of a LexA protein from Thermotoga maritima
Class: hydrolase
Keywords: winged helix-turn-helix, repressor, LexA, SOS system, Autocatalytic cleavage, DNA damage, DNA repair, DNA replication, DNA-binding, Hydrolase, SOS response, Transcription, Transcription regulation
Deposited on 2009-09-30, released 2010-10-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 1.37 Å
R-factor: N/A
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lexa repressor
    Species: Thermotoga maritima [TaxId:2336]
    Gene: lexA, TM_1082
    Database cross-references and differences (RAF-indexed):
    • Uniprot O33927 (1-195)
      • engineered (154)
    Domains in SCOPe 2.07: d3k2za1, d3k2za2
  • Chain 'B':
    Compound: lexa repressor
    Species: Thermotoga maritima [TaxId:2336]
    Gene: lexA, TM_1082
    Database cross-references and differences (RAF-indexed):
    • Uniprot O33927 (1-195)
      • engineered (154)
    Domains in SCOPe 2.07: d3k2zb1, d3k2zb2
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3k2zA (A:)
    mdlterqrkvllfieefiekngyppsvreiarrfritprgallhlialekkgyierkngk
    pralrisksirnkipligeiragekreaieyledyieipesflssgydhfllkvkgesmi
    eehicdgdlvlvrrqdwaqngdivaamvdgevtlakfyqrgdtvelrpanremssmffra
    ekvkilgkvvgvfrkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3k2zA (A:)
    dlterqrkvllfieefiekngyppsvreiarrfritprgallhlialekkgyierkpral
    risksirnkipligeiragekreaieyledyieipesflssgydhfllkvkgesmieehi
    cdgdlvlvrrqdwaqngdivaamvdgevtlakfyqrgdtvelrpanremssmffraekvk
    ilgkvvgvfrkl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3k2zB (B:)
    mdlterqrkvllfieefiekngyppsvreiarrfritprgallhlialekkgyierkngk
    pralrisksirnkipligeiragekreaieyledyieipesflssgydhfllkvkgesmi
    eehicdgdlvlvrrqdwaqngdivaamvdgevtlakfyqrgdtvelrpanremssmffra
    ekvkilgkvvgvfrkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3k2zB (B:)
    dlterqrkvllfieefiekngyppsvreiarrfritprgallhlialekkgyierkngkp
    ralrisksirnkipligeiragekreaieyledyieipesflssgydhfllkvkgesmie
    ehicdgdlvlvrrqdwaqngdivaamvdgevtlakfyqrgdtvelrpanremssmffrae
    kvkilgkvvgvfrkl