PDB entry 3k23

View 3k23 on RCSB PDB site
Description: Glucocorticoid Receptor with Bound D-prolinamide 11
Class: transcription
Keywords: Glucocorticoid Receptor, Steroid Hormone Receptor, Nuclear Receptor, GR, glucocorticoids, alpha helical sandwich, meta-channel, Alternative initiation, Chromatin regulator, Disease mutation, DNA-binding, Metal-binding, Nucleus, Pseudohermaphroditism, Receptor, Steroid-binding, Transcription, Transcription regulation, Zinc-finger, Activator
Deposited on 2009-09-29, released 2009-10-27
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.229
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glucocorticoid receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: Grl, Nr3c1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04150
      • engineered (83)
      • engineered (119)
    Domains in SCOPe 2.06: d3k23a_
  • Chain 'B':
    Compound: Glucocorticoid receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: Grl, Nr3c1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04150
      • engineered (83)
      • engineered (119)
    Domains in SCOPe 2.06: d3k23b_
  • Chain 'C':
    Compound: Glucocorticoid receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: Grl, Nr3c1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04150
      • engineered (83)
      • engineered (119)
    Domains in SCOPe 2.06: d3k23c_
  • Chain 'D':
    Compound: nuclear receptor coactivator 2
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: nuclear receptor coactivator 2
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: nuclear receptor coactivator 2
    Database cross-references and differences (RAF-indexed):
  • Heterogens: JZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3k23A (A:)
    gsvpatlpqltptlvslleviepevlyagydssvpdstwrimttlnmlggrqviaavkwa
    kaipgfrnlhlddqmtllqyswmylmafalgwrsyrqssanllcfapdliineqrmtlpg
    mydqckhmlyvsselhrlqvsyeeylcmktllllssvpkdglksqelfdeirmtyikelg
    kaivkregnssqnwqrfyqltklldsmhevvenllnycfqtfldktmsiefpemlaeiit
    nqipkysngnikkllfhqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3k23A (A:)
    lpqltptlvslleviepevlyagydsvpdstwrimttlnmlggrqviaavkwakaipgfr
    nlhlddqmtllqyswmylmafalgwrsyrqssanllcfapdliineqgmydqckhmlyvs
    selhrlqvsyeeylcmktllllssvpkdglksqelfdeirmtyikelgkaivkregnssq
    nwqrfyqltklldsmhevvenllnycfqtfldkmsiefpemlaeiitnqipkysngnikk
    llfhq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3k23B (B:)
    gsvpatlpqltptlvslleviepevlyagydssvpdstwrimttlnmlggrqviaavkwa
    kaipgfrnlhlddqmtllqyswmylmafalgwrsyrqssanllcfapdliineqrmtlpg
    mydqckhmlyvsselhrlqvsyeeylcmktllllssvpkdglksqelfdeirmtyikelg
    kaivkregnssqnwqrfyqltklldsmhevvenllnycfqtfldktmsiefpemlaeiit
    nqipkysngnikkllfhqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3k23B (B:)
    qltptlvslleviepevlyagydssvpdstwrimttlnmlggrqviaavkwakaipgfrn
    lhlddqmtllqyswmylmafalgwrsyrqssanllcfapdliineqrmtlpgmydqckhm
    lyvsselhrlqvsyeeylcmktllllssvpkdglksqelfdeirmtyikelgkaivkres
    qnwqrfyqltklldsmhevvenllnycfqtfldktmsiefpemlaeiitnqipkysngni
    kkllfhq
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3k23C (C:)
    gsvpatlpqltptlvslleviepevlyagydssvpdstwrimttlnmlggrqviaavkwa
    kaipgfrnlhlddqmtllqyswmylmafalgwrsyrqssanllcfapdliineqrmtlpg
    mydqckhmlyvsselhrlqvsyeeylcmktllllssvpkdglksqelfdeirmtyikelg
    kaivkregnssqnwqrfyqltklldsmhevvenllnycfqtfldktmsiefpemlaeiit
    nqipkysngnikkllfhqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3k23C (C:)
    lpqltptlvslleviepevlyagydssvpdstwrimttlnmlggrqviaavkwakaipgf
    rnlhlddqmtllqyswmylmafalgwrsyrqssanllcfapdliineqrmtlpgmydqck
    hmlyvsselhrlqvsyeeylcmktllllssvpkdglkqelfdeirmtyikelgkaivkre
    gnssqnwqrfyqltklldsmhevvenllnycfqtfldktmiefpemlaeiitnqipkyni
    kkllfh
    

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.