PDB entry 3k22

View 3k22 on RCSB PDB site
Description: Glucocorticoid Receptor with Bound alaninamide 10 with TIF2 peptide
Class: transcription
Keywords: Glucocorticoid Receptor, Steroid Hormone Receptor, Nuclear Receptor, GR, glucocorticoids, alpha helical sandwich, meta-channel, Alternative initiation, Chromatin regulator, Disease mutation, DNA-binding, Isopeptide bond, Lipid-binding, Metal-binding, Nucleus, Phosphoprotein, Pseudohermaphroditism, Receptor, Steroid-binding, Transcription, Transcription regulation, Zinc-finger
Deposited on 2009-09-29, released 2010-08-11
The last revision prior to the SCOPe 2.06 freeze date was dated 2010-08-11, with a file datestamp of 2010-08-06.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.214
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glucocorticoid receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: GRL, NR3C1, PGR
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04150
      • engineered (83)
      • engineered (119)
    Domains in SCOPe 2.06: d3k22a_
  • Chain 'B':
    Compound: Glucocorticoid receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: GRL, NR3C1, PGR
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04150
      • engineered (83)
      • engineered (119)
    Domains in SCOPe 2.06: d3k22b_
  • Chain 'D':
    Compound: Transcriptional Intermediary Factor 2
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 3K22 (0-11)
  • Chain 'H':
    Compound: Transcriptional Intermediary Factor 2
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 3K22 (Start-11)
  • Heterogens: JZS, JZR, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3k22A (A:)
    gsvpatlpqltptlvslleviepevlyagydssvpdstwrimttlnmlggrqviaavkwa
    kaipgfrnlhlddqmtllqyswmylmafalgwrsyrqssanllcfapdliineqrmtlpg
    mydqckhmlyvsselhrlqvsyeeylcmktllllssvpkdglksqelfdeirmtyikelg
    kaivkregnssqnwqrfyqltklldsmhevvenllnycfqtfldktmsiefpemlaeiit
    nqipkysngnikkllfhqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3k22A (A:)
    pqltptlvslleviepevlyagydssvpdstwrimttlnmlggrqviaavkwakaipgfr
    nlhlddqmtllqyswmylmafalgwrsyrqsanllcfapdliineqrmtlpgmydqckhm
    lyvsselhrlqvsyeeylcmktllllssvpkdglksqelfdeirmtyikelgkaivkreg
    nssqnwqrfyqltklldsmhevvenllnycfqtfldktmsiefpemlaeiitnqipkysn
    gnikkllfhq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3k22B (B:)
    gsvpatlpqltptlvslleviepevlyagydssvpdstwrimttlnmlggrqviaavkwa
    kaipgfrnlhlddqmtllqyswmylmafalgwrsyrqssanllcfapdliineqrmtlpg
    mydqckhmlyvsselhrlqvsyeeylcmktllllssvpkdglksqelfdeirmtyikelg
    kaivkregnssqnwqrfyqltklldsmhevvenllnycfqtfldktmsiefpemlaeiit
    nqipkysngnikkllfhqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3k22B (B:)
    tlpqltptlvslleviepevlyagydssvpdstwrimttlnmlggrqviaavkwakaipg
    frnlhlddqmtllqyswmylmafalgwrsyrqsanllcfapdliineqrmtlpgmydqck
    hmlyvsselhrlqvsyeeylcmktllllssvpkdglksqelfdeirmtyikelgkaivkr
    ensqnwqrfyqltklldsmhevvenllnycfqtfldktmsiefpemlaeiitnqipkysn
    gnikkllfhq
    

  • Chain 'D':
    No sequence available.

  • Chain 'H':
    No sequence available.