PDB entry 3k0m

View 3k0m on RCSB PDB site
Description: Cryogenic structure of CypA
Class: isomerase
Keywords: proline isomerase, Cyclosporin, Host-virus interaction, Isomerase, Isopeptide bond, Phosphoprotein, Rotamase
Deposited on 2009-09-24, released 2009-12-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-06-19, with a file datestamp of 2013-06-14.
Experiment type: XRAY
Resolution: 1.25 Å
R-factor: 0.131
AEROSPACI score: 0.81 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cyclophilin a
    Species: Homo sapiens [TaxId:9606]
    Gene: PPIA, CYPA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3k0ma_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3k0mA (A:)
    mvnptvffdiavdgeplgrvsfelfadkvpktaenfralstgekgfgykgscfhriipgf
    mcqggdftrhngtggksiygekfedenfilkhtgpgilsmanagpntngsqffictakte
    wldgkhvvfgkvkegmniveamerfgsrngktskkitiadcgqle
    

    Sequence, based on observed residues (ATOM records): (download)
    >3k0mA (A:)
    vnptvffdiavdgeplgrvsfelfadkvpktaenfralstgekgfgykgscfhriipgfm
    cqggdftrhngtggksiygekfedenfilkhtgpgilsmanagpntngsqffictaktew
    ldgkhvvfgkvkegmniveamerfgsrngktskkitiadcgqle