PDB entry 3jz6

View 3jz6 on RCSB PDB site
Description: Crystal structure of Mycobacterium smegmatis Branched Chain Aminotransferase in complex with pyridoxal-5'-phosphate at 1.9 angstrom.
Class: transferase
Keywords: alpha/beta, Aminotransferase, Transferase
Deposited on 2009-09-23, released 2010-05-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-04-11, with a file datestamp of 2012-04-06.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.2
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: branched-chain amino acid aminotransferase
    Species: Mycobacterium smegmatis [TaxId:1772]
    Gene: ilvE, MSMEG_4276
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3jz6a_
  • Chain 'B':
    Compound: branched-chain amino acid aminotransferase
    Species: Mycobacterium smegmatis [TaxId:1772]
    Gene: ilvE, MSMEG_4276
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3jz6b_
  • Heterogens: PLP, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3jz6A (A:)
    mahhhhnsgpleftvsantnpatdavresilanpgfgkyytdhmvsidytvdegwhnaqv
    ipygpiqldpsaivlhygqeifeglkayrwadgsivsfrpeanaarlqssarrlaipelp
    eevfieslrqliavdekwvppaggeeslylrpfviatepglgvrpsneyrylliaspaga
    yfkggikpvsvwlsheyvraspggtgaakfggnyaasllaqaqaaemgcdqvvwldaier
    ryveemggmnlffvfgsggsarlvtpelsgsllpgitrdsllqlatdagfaveerkidvd
    ewqkkagageitevfacgtaavitpvshvkhhdgeftiadgqpgeitmalrdtltgiqrg
    tfadthgwmarln
    

    Sequence, based on observed residues (ATOM records): (download)
    >3jz6A (A:)
    leftvsantnpatdavresilanpgfgkyytdhmvsidytvdegwhnaqvipygpiqldp
    saivlhygqeifeglkayrwadgsivsfrpeanaarlqssarrlaipelpeevfieslrq
    liavdekwvppaggeeslylrpfviatepglgvrpsneyrylliaspagayfkggikpvs
    vwlsheyvraspggtgaakfggnyaasllaqaqaaemgcdqvvwldaierryveemggmn
    lffvfgsggsarlvtpelsgsllpgitrdsllqlatdagfaveerkidvdewqkkagage
    itevfacgtaavitpvshvkhhdgeftiadgqpgeitmalrdtltgiqrgtfadthgwma
    rln
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3jz6B (B:)
    mahhhhnsgpleftvsantnpatdavresilanpgfgkyytdhmvsidytvdegwhnaqv
    ipygpiqldpsaivlhygqeifeglkayrwadgsivsfrpeanaarlqssarrlaipelp
    eevfieslrqliavdekwvppaggeeslylrpfviatepglgvrpsneyrylliaspaga
    yfkggikpvsvwlsheyvraspggtgaakfggnyaasllaqaqaaemgcdqvvwldaier
    ryveemggmnlffvfgsggsarlvtpelsgsllpgitrdsllqlatdagfaveerkidvd
    ewqkkagageitevfacgtaavitpvshvkhhdgeftiadgqpgeitmalrdtltgiqrg
    tfadthgwmarln
    

    Sequence, based on observed residues (ATOM records): (download)
    >3jz6B (B:)
    leftvsantnpatdavresilanpgfgkyytdhmvsidytvdegwhnaqvipygpiqldp
    saivlhygqeifeglkayrwadgsivsfrpeanaarlqssarrlaipelpeevfieslrq
    liavdekwvppaggeeslylrpfviatepglgvrpsneyrylliaspagayfkggikpvs
    vwlsheyvraspggtgaakfggnyaasllaqaqaaemgcdqvvwldaierryveemggmn
    lffvfgsggsarlvtpelsgsllpgitrdsllqlatdagfaveerkidvdewqkkagage
    itevfacgtaavitpvshvkhhdgeftiadgqpgeitmalrdtltgiqrgtfadthgwma
    rln